Conserved Protein Domain Family
PRK14572

?
PRK14572: PRK14572 
D-alanyl-alanine synthetase A; Provisional
Statistics
?
PSSM-Id: 173036
View PSSM: PRK14572
Aligned: 6 rows
Threshold Bit Score: 609.214
Threshold Setting Gi: 183221247
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
183221247   3 KIKIALLFGGISGEHIISVRSSAFIFATIDREKYDVCPVYINPNGKFWIPTVSEPIYPDPSGKTEIEFLQEFNKANAIvs 82 
189911338   3 KIKIALLFGGISGEHIISVRSSAFIFATIDREKYDVCPVYINPNGKFWIPTVSEPIYPDPSGKTEIEFLQEFNKANAIvs 82 
116328043   1 MAKIAVFFGGSSTEHSISIRTGCFICRTLHTMGHSVKPILLTQDGGWVVPLQYRISIPYEAVNSSDLFEEEFQKTNGV-- 78 
116331504   1 MAKIAVFFGGSSTEHSISIRTGCFICRTLHTMGHSVKPILLTQDGGWVVPLQYRISIPYEAVNSSDLFEEEFQKTNGV-- 78 
24214759    1 MAKIAVFFGGSSTEHSISILTGCFICKTLHTMGHSVKPILLTKDGGWVVPSEYRMSIPFEVSNSPDLFQEEFQKRYGV-- 78 
45657718    1 MAKIAVFFGGSSTEHSISILTGCFICKTLHTMGHSVKPILLTKDGGWVVPSEYRMSIPFEVSNSPDLFQEEFQKRYGV-- 78 
183221247  83 pSEPADISQMGFLSAFLGLHGGAGEDGRIQGFLDTLGIPHTGSGVLASSLAMDKYRANILFEAMGIPVAPFLELEKGK-- 160
189911338  83 pSEPADISQMGFLSAFLGLHGGAGEDGRIQGFLDTLGIPHTGSGVLASSLAMDKYRANILFEAMGIPVAPFLELEKGK-- 160
116328043  79 -SKMDFISNLDADIVFLGLHGGKGEDGSIQGFLRVLGVPYTGSGVAASALAMDKTRANQIFLQSGQKVAPFFEVEKLGyt 157
116331504  79 -SKMDFISNLDADIVFLGLHGGKGEDGSIQGFLRVLGVPYTGSGVAASALAMDKTRANQIFLQSGQKVAPFFEVEKLGyt 157
24214759   79 -SRTNQIFSLDADIVFLGLHGGQGEDGTIQGFLEILGIPYTGSGVLASAIAMDKTRANQIFLQSGQKVAPFFEIDKLEyl 157
45657718   79 -SRTNQIFSLDADIAFLGLHGGQGEDGTIQGFLEILGIPYTGSGVLASAIAMDKTRANQIFLQSGQKVAPFFEIDKLEyl 157
183221247 161 TDPRKTLLNL-SFSYPVFIKPTLGGSSVNTGMAKTAEEAMTLVDKIFVTDDRVLVQKLVSGTEVSIGVLEKPEGKKRNPF 239
189911338 161 TDPRKTLLNL-SFSYPVFIKPTLGGSSVNTGMAKTAEEAMTLVDKIFVTDDRVLVQKLVSGTEVSIGVLEKPEGKKRNPF 239
116328043 158 NSPEETVIKLmSLGFPQFLKPVEGGSSVSTYKITNQEQLSRQLALIFESDSKVMSQSFLAGTEVSCGVLERYRNGKLERI 237
116331504 158 NSPEETVIKLmSLGFPQFLKPVEGGSSVSTYKITNQEQLSRQLALIFESDSKVMSQSFLAGTEVSCGVLERYRNGKLERI 237
24214759  158 NSTDAVITKLeTLGFPQFLKPVEGGSSVSVYKITNREQLKEKLALIFESDSKVMSQSFLTGIEVSCGVLERYRDGKFKKI 237
45657718  158 NSTDAVITKLeTLGFPQFLKPVEGGSSVSVYKITNREQLKEKLALIFESDSKVMSQSFLTGIEVSCGVLERYRDGKFKKI 237
183221247 240 PLVPTEIRPKSEFFDFEAKYTKGASEEITPAPVGDEVTKTLQEYTLRCHEILGCKGYSRTDFIISDGVPYVLETNTLPGM 319
189911338 240 PLVPTEIRPKSEFFDFEAKYTKGASEEITPAPVGDEVTKTLQEYTLRCHEILGCKGYSRTDFIISDGVPYVLETNTLPGM 319
116328043 238 ALPATEIVPGGEFFDFESKYKQGGSREITPARISKQEMTRVQELAIDAHTSLGCRGYSRSDFIIVGGEPHILETNTLPGM 317
116331504 238 ALPATEIVPGGEFFDFESKYKQGGSREITPARISKQEMTRVQELAIDAHTSLGCRGYSRSDFIIVGGEPHILETNTLPGM 317
24214759  238 ALPATEIVPGGEFFDFESKYKQGGSHEITPARISEQEMKRVQELAIAAHRSLGCSGYSRTDFIIVNGEPHILETNTLPGM 317
45657718  238 ALPATEIVPGGEFFDFESKYKQGGSHEITPARISEQEMKRVQELAIAAHRSLGCSGYSRTDFIIVNGEPHILETNTLPGM 317
183221247 320 TGTSLIPQQAKALGINMKDVFTWLLEISLS 349
189911338 320 TGTSLIPQQAKALGINMKDVFTWLLEISLS 349
116328043 318 TETSLIPQQAKAAGITMEEVFADLIEIGLK 347
116331504 318 TETSLIPQQAKAAGITMEEVFADLIEIGLK 347
24214759  318 TETSLIPQQAKAAGISMEEVFSDLIEIGLK 347
45657718  318 TETSLIPQQAKAAGISMEEVFSDLIEIGLK 347
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap