Conserved Protein Domain Family
PRK14570

?
PRK14570: PRK14570 
D-alanyl-alanine synthetase A; Provisional
Links
?
Statistics
?
PSSM-Id: 173034
View PSSM: PRK14570
Aligned: 8 rows
Threshold Bit Score: 666.535
Threshold Setting Gi: 15594545
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
203287658   1 MKKNLMLIFGGVSFEHEISLRSAYGIYSSLLKLDKYNVFSIFVDKVTGIWYLLDSVPSSAELIKRHTTSIVNFIPGCGIF 80 
203284120   1 MKKNLMLIFGGVSFEHEISLRSAYGIYSSLLKLDKYNVFSVFVDKVTGIWYLLDSVPSSAELIKRHTTSIVNFIPGCGIF 80 
187918073   2 MKKNLMLIFGGVSFEHEISLRSAYGIYSALMKLDKYNLYPSFIDKITGIWYLLDSVPDAPELIKRDSSAIISLIPGCGIF 81 
218249946   1 MKKNLMLIFGGVSFEHEISCKSAYSIYLALLDLNKYNIYPVYIDKCTGVWYLLDSVSDPPKPINTDVLPIVSLLPGFGIF 80 
111115023   1 MKKNLMLIFGGVSFEHEISCKSAYSVYLALLDLNKYNIYSAYIDKCTGIWYLLDSVSDPPKPIDTDVLPIVSLLPGFGIF 80 
119952997   2 MKKNLMLIFGGVSFEHEISLRSACGIYSALMKLDKYNVFSSFIDKITGVWYLLDSVPDDPKLIKKDSSAIISLIPGYGIF 81 
51598461    1 MKKNLMLIFGGVSFEHEISCKSAYSIYLALLDLNKYNIYPVYIDKCTGIWYLLDSVSDPPKLIDIDVLPIVSLLPGIGIF 80 
15594545    1 -----MLIFGGVSFEHEISCKSAYSIYLALLDLNKYNIYPVYIDKCTGVWYLLDSVSDPPKPINTDVLPIVSLLPGFGIF 75 
203287658  81 VNNKSLEIDVIFPIIHGRTGEDGAIQGFVKMMDIPCVGAGILGSAISINKYFCKVLLKSFNIPVVSFIGFKKDDYILNKE 160
203284120  81 VNNKSLEIDVIFPIIHGRTGEDGAIQGFVKMMDIPCVGAGILGSAISINKYFCKVLLKSFNIPVVSFIGFKKDDYILNKE 160
187918073  82 VNDEDLEIDVVFPIVHGRTGEDGAIQGFLKMMDIPCVGAGILGSAISINKYFCKLLLKSFNIPLVPFIGFRKYDYFLDKE 161
218249946  81 SNNKNLEIDVVFPVVHGRTGEDGAIQGVLKVMDIPCVGAGIIGSAISSNKYFCKLLLKSFDIPLVPFIGFRQHDYFLDKE 160
111115023  81 SNNKNLEIDVVFPVVHGRTGEDGAIQGVLKVMDIPCVGAGIIGSAISSNKYFCKLLLKSFNIPIVPFIGFRQYDYSLDKE 160
119952997  82 VNNKDLKIDVVFPIVHGRTGEDGAIQGFLKIMDIPCVGSGILGSAISINKYFCKLLLKSFNIPLVPFIGFKKYDYLLDKE 161
51598461   81 SNNKNLDIDVVFPVVHGRTGEDGAIQGVLKVMDIPCIGAGIIGSAISSNKYFCKLLLKSFNIPLVPFIGFRQYDYFLDKE 160
15594545   76 SNNKNLEIDVVFPVVHGRTGEDGAIQGVLKVMDIPCVGAGIIGSAISSNKYFCKLLLKSFDIPLVPFIGFRQHDYFLDKE 155
203287658 161 GIKEDINNKLNYPVIVKPSVLGSSIGINVAYNVSQIEKYIEEAFEYDLTVVVEKFIKAREIECAVIGNDQIKIFTPGEIV 240
203284120 161 GIKEDINNKLNYPVIVKPSVLGSSIGINVAYNVSQIEKYIEEAFEYDLTVVVEKFIKAREIECAVIGNDQIKIFTPGEIV 240
187918073 162 GIKKDIKQSLNYPVIVKPAMLGSSIGISIAYNDTQIEKCIEEAFEYDLTVVVEKFMKVREIECSVIGNEQIKIFTPGEIV 241
218249946 161 EIKKNVKEVLGYPVIVKPAVLGSSIGINVAYSENQIESFIKEALKYDLTIVIEKFIEAREIECSIIGNEKMKIFSPGEVV 240
111115023 161 EIKRNVKEVLGYPVIVKPAVLGSSIGINVAYSENQIESCIEEALKYDLTIVIEKFIEAREIECSIIGNEKMKIFSPGEVV 240
119952997 162 GIKKDIKQSLDYPVIVKPAMLGSSIGISIAYNETQIEKCIEEAFAYDLTVVIEKFMRAREIECAVIGNEQIKIFTPGEIV 241
51598461  161 EVKRNVREALGYPVIVKPAVLGSSIGINVAYSENQIEFFIEEALKYDLTILIEKFIEAREIECSIIGNEKIKIFSPGEVI 240
15594545  156 EIKRNVKEVLGYPVIVKPAVLGSSIGINVAYSENQIESFIKEALKYDLTIVIEKFIEAREIECSIIGNEKMKIFSPGEVV 235
203287658 241 VQDFIFYDYDAKYSTVPGDSIVFNIPAHLDMKHLLDIKEYAFLTYKYLELRGMARIDFLISKDTNLLYVNEVNTIPGFTD 320
203284120 241 VQDFIFYDYDAKYSTVPGDSIVFNIPAHLDMKHLLDIKEYAFLTYKYLELRGMARIDFLISKDTNLLYVNEVNTIPGFTD 320
187918073 242 VQDFVFYDYDAKYSTIPGNSVVFNIPARLDMKHLLDIKEYAFLTYKCLELRGMARIDFLIEKDTNLIYVNEINTIPGFTD 321
218249946 241 VQDFIFYDYDAKYSVIPGNSIIFNIPAHLETNQLLSIKEYAFLAYKNLELRGMARVDFFVEKKSGTIYLNEINTIPGFTD 320
111115023 241 VQDFIFYDYDAKYSVIPGNSIIFNIPAHLETNQLLSIKEYAFLVYKNLELRGMARVDFFVEKKSGTIYLNEINTIPGFTD 320
119952997 242 IQDFVFYDYDAKYSTAPGNSVVFNIPAHLDTKHLLDIKEYAFFTYKCLELRGMARIDFLIEKDTDLVYINEINTIPGFTD 321
51598461  241 VQDFIFYDYDAKYSVIPGNSIIFNIPAQLETNQLLSIKEYAFLVYKNLELRGMARVDFFVEKKSGKIYLNEINTIPGFTD 320
15594545  236 VQDFIFYDYDAKYSVIPGNSIIFNIPAHLETNQLLSIKEYAFLTYKNLELRGMARVDFFVEKKSGTIYLNEINTIPGFTD 315
203287658 321 ISMFAKMCEHDGLSYESLVDKLITLAFESYKKRKDKIDFTRLES 364
203284120 321 ISMFAKMCEHDGLSYESLVDKLITLAFESYKKRKDKIDFTRLES 364
187918073 322 ISMFSKMCEHDGLDYESLVDNLVSLAFQSYAKRKERIDFKRLEN 365
218249946 321 ISMFAKMCSNDGLQFKDLVDNLIDYAFQSYINRKKRIDFEN--- 361
111115023 321 ISMFSKMCSHDGLQFKDLIDNLIDYAFQSYINRKKRINFKD--- 361
119952997 322 ISMFSKMCEHDGLDYGSLVDKLIALAFQSYAKRKERIDFHRLEN 365
51598461  321 ISMFAKMCSHDGLQFKDLVDNLINYAFQSYINRKKRINFED--- 361
15594545  316 ISMFAKMCSNDGLQFKDLVDNLIDYAFQSYINRKKRIDFEN--- 356
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap