Conserved Protein Domain Family
PRK14569

?
PRK14569: PRK14569 
D-alanyl-alanine synthetase A; Provisional
Statistics
?
PSSM-Id: 173033
View PSSM: PRK14569
Aligned: 8 rows
Threshold Bit Score: 572.389
Threshold Setting Gi: 134302707
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
56707350    1 MKNEKIVVLYGGDSPEREVSLKSGKAVLDSLISQGYDAVGVDASGKELVAKLLELKPDKCFVALHGEDGENGRVSALLEM 80 
118496775   1 MKNEKIVVLYGGDSPEREVSLKSGKAVLDSLISQGYDAVGVDASGKELVAKLLELKPDKCFVALHGEDGENGRVSALLEM 80 
134302707   1 MKNEKIVVLYGGDSPEREVSLKSGKAVLDSLISQGYDAVGVDASGKELVAKLLELKPDKCFVALHGEDGENGRVSALLEM 80 
156503383   1 MKNEKIVVLYGGDSPEREVSLKSGKAVLDSLISQGYDAVGVDASGKELVAKLLELKPDKCFVALHGEDGENGRVSALLEM 80 
110669820   1 MKNEKIVVLYGGDSPEREVSLKSGKAVLDSLISQGYDAVGVDASGKELVAKLLELKPDKCFVALHGEDGENGRVSALLEM 80 
115315497   1 MKNEKIVVLYGGDSPEREVSLKSGKAVLDSLISQGYDAVGVDASGKELVAKLLELKPDKCFVALHGEDGENGRVSALLEM 80 
89257158    1 MKNEKIVVLYGGDSPEREVSLKSGKAVLDSLISQGYDAVGVDASGKELVAKLLELKPDKCFVALHGEDGENGRVSALLEM 80 
167626884   1 MQKEKIVVLYGGDSPEREVSLKSGKAVLDSLLNQGYDAVGLDASSKDLVVKLLELNPDKCFIALHGEDGENGRVAALLEL 80 
56707350   81 LEIKHTSSSMKSSVITMDKMISKEILMHHRMPTPMAKFLTDKLVAEDEISFPVAVKPSSGGSSIATFKVKSIQELKHAYE 160
118496775  81 LEIKHTSSSMKSSVITMDKMISKEILMHHRMPTPMAKFLTDKLVAEDEISFPVAVKPSSGGSSIATFKVKSIQELKHAYE 160
134302707  81 LEIKHTSSSMKSSVITMDKMISKEILMHYRMPTPMAKFLTDKLVAEDEISFPVAVKPSSGGSSIATFKVKSIQELKHAYE 160
156503383  81 LEIKHTSSSMKSSVITMDKMISKEILMHHRMPTPMAKFLTDKLVAEDEISFPVAVKPSSGGSSIATFKVKSIQELKHAYE 160
110669820  81 LEIKHTSSSMKSSVITMDKMISKEILMHHRMPTPMAKFLTDKLVAEDEISFPVAVKPSSGGSSIATFKVKSIQELKHAYE 160
115315497  81 LEIKHTSSSMKSSVITMDKMISKEILMHHRMPTPMAKFLTDKLVAEDEISFPVAVKPSSGGSSIATFKVKSIQELKHAYE 160
89257158   81 LEIKHTSSSMKSSVITMDKMISKEILMHHRMPTPMAKFLTDKLVAEDEISFPAAVKPSSGGSSIATFKVKSIQELKHAYE 160
167626884  81 LGIKHTGSTMKSCVVTMDKMISKEILMHHRMPTPMAKFLTDRLVEADEISFPVAVKPSSGGSSIATFKVKSLEELENAYQ 160
56707350  161 EASKYGEVMIEQWVTGKEITVAIVNDEVYSSVWIEPQNEFYDYESKYSGKSIYHSPSGLCEQKELEVRQLAKKAYDLLGC 240
118496775 161 EASKYGEVMIEQWVTGKEITVAIVNDEVYSSVWIEPQNEFYDYESKYSGKSIYHSPSGLCEQKELEVRQLAKKAYDLLGC 240
134302707 161 EASKYGEVMIEQWVTGKEITVAIVNDEVYSSVWIEPQNEFYDYESKYSGKSIYHSPSGLCEQKELEVRQLAKKAYDLLGC 240
156503383 161 EASKYGEVMIEQWVTGKEITVAIVNDEVYSSVWIEPQNEFYDYESKYSGKSIYHSPSGLCEQKELEVRQLAKKAYDLLGC 240
110669820 161 EASKYGEVMIEQWVTGKEITVAIVNDEVYSSVWIEPQNEFYDYESKYSGKSIYHSPSGLCEQKELEVRQLAKKAYDLLGC 240
115315497 161 EASKYGEVMIEQWVTGKEITVAIVNDEVYSSVWIEPQNEFYDYESKYSGKSIYHSPSGLCEQKELEVRQLAKKAYDLLGC 240
89257158  161 EASKYGEVMIEQWVTGKEITVAIVNDEVYSSVWIEPQNEFYDYESKYSGKSIYHSPSGLCEQKELEVRQLAKKAYDLLGC 240
167626884 161 QASKHGEVMIEQWVTGKEITVAIVNNDVYSSVWIEPLNEFYDYESKYSGKSIYHAPSGLCEQKELEVRQLAKKAYDLLGC 240
56707350  241 SGHARVDFIYDDRGNFYIMEINSSPGMTDNSLSPKSAAAEGVDFDSFVKRIIEQAQ 296
118496775 241 SGHARVDFIYDDRGNFYIMEINSSPGMTENSLSPKSAAAEGVDFDSFVKRIIEQAQ 296
134302707 241 SGHARVDFIYDDRGNFYIMEINSSPGMTDNSLSPKSAAAEGVDFDSFVKRIIEQAQ 296
156503383 241 SGHARVDFIYDDRGNFYIMEINSSPGMTDNSLSPKSAAAEGVDFDSFVKRIIEQAQ 296
110669820 241 SGHARVDFIYDDRGNFYIMEINSSPGMTDNSLSPKSAAAEGVDFDSFVKRIIEQAQ 296
115315497 241 SGHARVDFIYDDRGNFYIMEINSSPGMTDNSLSPKSAAAEGVDFDSFVKRIIEQAQ 296
89257158  241 SGHARVDFIYDDRGNFYIMEINSSPGMTDNSLSPKSAAAEGVDFDSFVKRIIEQAQ 296
167626884 241 KGHARVDFIYDDKGDFYIMEINSSPGMTENSLSPKSAAAEGIDFDSFVKSILEQAQ 296
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap