Conserved Protein Domain Family
PRK14567

?
PRK14567: PRK14567 
triosephosphate isomerase; Provisional
Statistics
?
PSSM-Id: 173031
View PSSM: PRK14567
Aligned: 9 rows
Threshold Bit Score: 493.006
Threshold Setting Gi: 134301294
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
56707259    6 MGNWKMNGNSTSIKELCSGISQVQYDTSRVAIAVFPSSVYVKEVISQLPEKVGVGLQNITFYDDGAYTGEISARMLEDIG 85 
134301294   1 MGNWKMNGNSTSIKELCSGISQVQYDTSRVAIAVFPSSVYVKEVISQLPEKVGVGLQNITFYDDGAYTGEISARMLEDIG 80 
118498193   6 MGNWKMNGNSTSIKELCSGISQAQYDTSRVAIAVFPSSVYVKEVISQLPEKVGVGLQNITFYDDGAYTGEISARMLEDIG 85 
115315398   6 MGNWKMNGNSTSIKELCSGISQVQYDTSRVAIAVFPSSVYVKEVISQLPEKVGVGLQNITFYDDGAYTGEISARMLEDIG 85 
110669729   6 MGNWKMNGNSTSIKELCSGISQVQYDTSRVAIAVFPSSVYVKEVISQLPEKVGVGLQNITFYDDGAYTGEISARMLEDIG 85 
89257043    6 MGNWKMNGNSTSIKELCSGISQVQYDTSRVAIAVFPSSVYVKEVISQLPEKVGVGLQNITFYDDGAYTGEISARMLEDIG 85 
167627201   6 MGNWKMNGSSASIKELCKGISEVNYNSEKVAVAVFPSSVYVKEVLAQLPKEIGVGLQNITFYDNGAYTGELSAEMLHDVG 85 
169656755   6 MGNWKMNGNSTSIKELCSGISQVQYDTSRVAIAVFPSSVYVKEVISQLPEKVGVGLQNITFYDDGAYTGEISARMLEDIG 85 
187931036   6 MANWKMNGNSTSIKELCSGISQVQYDTSRVAIAVFPSSVYVKEVISQLPEKVGVGLQNITFYDDGAYTGEISARMLEDIG 85 
56707259   86 CDYLLIGHSERRSLFAESDEDVFKKLNKIIDTTITPVVCIGESLDDRQSGKLKQVLATQLSLILENLSVEQLAKVVIAYE 165
134301294  81 CDYLLIGHSERRSLFAESDEDVFKKLNKIIDTTITPVVCIGESLDDRQSGKLKQVLATQLSLILENLSVEQLAKVVIAYE 160
118498193  86 CDYLLIGHSERRSLFAESDEDVFKKLNKIIDTTITPVVCIGESLDDRQSGKLKQVLATQLSLILENLSVEQLAKVVIAYE 165
115315398  86 CDYLLIGHSERRSLFAESDEDVFKKLNKIIDTTITPVVCIGESLDDRKSGKLKQVLATQLSLILENLSVEQLAKVVIAYE 165
110669729  86 CDYLLIGHSERRSLFAESDEDVFKKLNKIIDTTITPVVCIGESLDDRQSGKLKQVLATQLSLILENLSVEQLAKVVIAYE 165
89257043   86 CDYLLIGHSERRSLFAESDEDVFKKLNKIIDTTITPVVCIGESLDDRKSGKLKQVLATQLSLILENLSVEQLAKVVIAYE 165
167627201  86 CNYLLIGHSERRSLFGETDQDVFKKLNKIIDTSVVPVVCIGESLEDRQGGRLEKVLTTQLSLILENLSIEQLARVIIAYE 165
169656755  86 CDYLLIGHSERRSLFAESDEDVFKKLNKIIDTTITPVVCIGESLDDRKSGKLKQVLATQLSLILENLSVEQLAKVVIAYE 165
187931036  86 CDYLLIGHSERRSLFAESDEDVFKKLNKIIDTTITPVVCIGESLDDRQSGKLKQVLATQLSLILENLSVEQLAKVVIAYE 165
56707259  166 PVWAIGTGVVASLEQIQETHQFIRSLLAKVDERLAKNIKIVYGGSLKAENAKDILSLPDVDGGLIGGASLKAAEFNEIIN 245
134301294 161 PVWAIGTGVVASLEQIQETHQFIRSLLAKVDERLAKNIKIVYGGSLKAENAKDILSLPDVDGGLIGGASLKAAEFNEIIN 240
118498193 166 PVWAIGTGVVASLDQIQETHQFIRSLLAKVDERLAKNIKIVYGGSLKAENAKDILSLPDVDGGLIGGASLKAAEFNEIIN 245
115315398 166 PVWAIGTGVVASLEQIQETHQFIRSLLAKVDERLAKNIKIVYGGSLKAENAKDILSLPDVDGGLIGGASLKAAEFNEIIN 245
110669729 166 PVWAIGTGVVASLEQIQETHQFIRSLLAKVDERLAKNIKIVYGGSLKAENAKDILSLPDVDGGLIGGASLKAAEFNEIIN 245
89257043  166 PVWAIGTGVVASLEQIQETHQFIRSLLAKVDERLAKNIKIVYGGSLKAENAKDILSLPDVDGGLIGGASLKAAEFNEIIN 245
167627201 166 PVWAIGTGVVASLEQVQETHQFIRSLVAKVDENLAKNMKIVYGGSLKAENAKDILSLPDVDGGLIGGASLKASEFNEIIN 245
169656755 166 PVWAIGTGVVASLEQIQETHQFIRSLLAKVDERLAKNIKIVYGGSLKAENAKDILSLPDVDGGLIGGASLKAAEFNEIIN 245
187931036 166 PVWAIGTGVVASLEQIQETHQFIRSLLAKVDEKLAKNIKIVYGGSLKAENAKDILSLPNVDGGLIGGASLKAVEFNEIIN 245
56707259  246 QANKICTE 253
134301294 241 QANKICTE 248
118498193 246 QANKICTE 253
115315398 246 QANKICTE 253
110669729 246 QANKICTE 253
89257043  246 QANKICTE 253
167627201 246 QANKICTE 253
169656755 246 QANKICTE 253
187931036 246 QANKICTE 253
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap