Conserved Protein Domain Family
pyrH

?
PRK14558: pyrH 
uridylate kinase; Provisional
Statistics
?
PSSM-Id: 173023
View PSSM: PRK14558
Aligned: 11 rows
Threshold Bit Score: 399.471
Threshold Setting Gi: 239618074
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15644352    1 MRVLVKLSGEALSGEGGRGFDPERVNYIVNEIKSAIEEGFKIGIVVGAGNLFRGVELKNLTMTRADQIGLLGTVMNSVYL 80 
157363679   3 QRVLVKLSGEVMCGEGSRGFDQSNINYLVQQIAQIVDYGVNVGIVIGAGNIFRGEELSEIPHSLADQIGMLGTVINALYL 82 
150020380   3 KRVLLKLSGEVLSGEGEKGFNHENIIYLVDELKKILEYGTNVGIVIGAGNLFRGREMQELSPTIADQIGMLGTVINALYL 82 
148270318   1 MRVLVKLSGEALSGEGGRGFDPERVNYIVTEIKSVVEEGFKIGIVVGAGNLFRGVELKNLTMARADQIGLLGTVMNSVYL 80 
154249513   3 KRVLLKLSGEVLSGEDQKGFNEEHVEYLIKEIKGISEYGTKLGIVIGAGNIFRGRDFEGLRPTISDQIGMLGTVINALYL 82 
222099828   1 MRVLVKLSGEALSGEGRKGFDPERVSYLTSEIKKVVEEGYRVGIVVGAGNLFRGIELRGLSRERADQIGLLGTVMNAVYL 80 
217076883   3 KRVLLKLSGEVLSGEGEKGFNIDKIIYLIDELKSVLEYGTNIGIVIGAGNLFRGREMKELSPTIADQIGMLGTVINALYL 82 
160903156   3 KRVLLKLSGEALSGESEKGFSEQMLTYLVNEIKKIHSLNIKLGIVTGAGNIFRGKELKDFQIQMADQLGMLGTVINSLYL 82 
170289056   1 MRVLVKLSGEAFSGEGGRGFDPERVNYIVNEIKSAIEEGFKIGIVVGAGNLFRGVELKNLTMTRADQIGLLGTVMNSVYL 80 
239618074   3 RRVLLKLSGEALSGEGNKGFSEERLQYLVNELRGVKERGIEIAIVIGAGNLFRGKELTHISPTVSDEIGMLGTLINTLYL 82 
281412624   1 MRVLVKLSGEALSGEGGRGFDPERVDYIVTEIKSVVEEGFKIGIVVGAGNLFRGVELKNLTMARADQIGLLGTVMNSIYL 80 
15644352   81 KDIFERSGLKARIYSQIVNLPDVERVNYDSIESALRENSILIFAGGTSNPFFTTDTAAVLRAQEMRAKLVVKATKVDGVY 160
157363679  83 KGSLQKVGIKCVVVSQVTSLPSIRPIHYDDINLYFDAGYVVIFAGGTSNPFFTTDTAAALRAVEMGANLLIKATKVDGIY 162
150020380  83 KDIFEKNNLRTVVVSQVSSLPSIRPIHYDDINLYFDAGYLVIFAGGTSNPFFTTDTAAALRAVEMKADILIKGTKVDGIY 162
148270318  81 KDIFERSGLKARIYSQIVNLPDVERVNYDSIESALRENSILIFAGGTSNPFFTTDTAAVLRAQEMKAKLVVKATKVDGVY 160
154249513  83 KDRFENAGIRTVIVSQIVTLPSVKLINYDDIDLYFDAGYVVIFAGGTSNPFFTTDTGAALRAVEMKAELLIKGTKVCGIY 162
222099828  81 KDHFEREGLKTKIFSQIVNLPDVESVSYDSIESAIENGFVLIFAGGTSNPFFTTDTAAVLRAKEMKAQIIVKATKVDGIY 160
217076883  83 KDLFEKHGLRTVVVSQVTSLPSIRPIHYDDINLYFDAGYLVIFAGGTSNPFFTTDTAAALRAVEMKADILIKGTKVSGIF 162
160903156  83 KNLFEKNGLKSIIVSPIVNLPSVLPLKYDFIEQYFEAGYIVLFGGGTSNPLFTTDTAAALRAIEMNADILVKATKVDGIY 162
170289056  81 KDIFERSGLKARIYSQIVNLPDVERVNYDSIESALRENSILIFAGGTSNPFFTTDTAAVLRAQEMRAKLVVKATKVDGVY 160
239618074  83 KDYLSSKGLKAVAISSIVSFPSFEPYKYSRAEQLLREGNIVILGGGTTIPYFTTDTAAAIRAIELHTDIIIKATKVDGVY 162
281412624  81 KDIFERSGLKARIYSQIVNLPDVERVNYDSIESALRENSILIFAGGTSNPFFTTDTAAVLRAQEMKAKLVVKATKVDGVY 160
15644352  161 DKDPKKFPDAKKIPHLTFSEAMKMGLKVMDAEAFALCKKLGITVKVINFFEPGTLLKALKGEDVGSTVVPD 231
157363679 163 DSDPKKNKSARKLDKISYYDAISRGLKVMDMEAFSICGRYKLPIVILNFFEDGSLLRAVRGEDVGSIIMPD 233
150020380 163 DKDPKKFTDARKFDTLTYDEAIDKGLKIMDTEAFSICKRYDMKILVMDFFKESNLLSAVREENVGTLVVPK 233
148270318 161 DKDPKKFPDAKKIPHLTFSEAMKMGLKVMDAEAFALCKKLGITVKVINFFEPGTLLKALKGEDVGSTVVPD 231
154249513 163 DKDPKKYSDAKKYNVITYDEAIEKNLKIMDTEAFSICKRYNMKILVMNFFENGNLLKAIKGENVGTLVVPK 233
222099828 161 DKDPKRFSDARKIERLTFSEAMKMRIEVMDAEAFALCKKLGITVRVINFFEPGSLLRALKGENIGSIVLPD 231
217076883 163 DKDPKKYEDAIKFDKLTFDEAIEKELKIMDTEAFSICRRYNMKILVMDFFKKGNLLRAIREENVGTLVVPK 233
160903156 163 DKDPKLFEDAKKYNNITYEQAIKEQIKVMDTEAFSICEKNNLSILIINFFKEGSLLKAVEGENIGTKVDH- 232
170289056 161 DKDPKKFPDAKKIPHLTFSEAMKMGLKVMDAEAFALCKKLGITVKVINFFEPGTLLKALKGEDVGSTVVPD 231
239618074 163 ELDPKKHPDTKKIDRITFTEAIERDLKIMDIEAFSICKKHKIPIIVIDFFTSGNLLRAIIGEKVGTLVIPD 233
281412624 161 DKDPKKFPDAKKIPHLTFSEAMKMGLKVMDAEAFALCKKLGITVKVINFFEPGTLLKALKGEDVGSTVVPD 231
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap