Conserved Protein Domain Family
pyrH

?
PRK14557: pyrH 
uridylate kinase; Provisional
Links
?
Statistics
?
PSSM-Id: 173022
View PSSM: PRK14557
Aligned: 20 rows
Threshold Bit Score: 460.515
Threshold Setting Gi: 225863703
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
163939648   1 MKPYKRVLIKLSGGALADQSGNSFNSKRLEHIANEIISIIDLDIEVSIVIGGGNIFRGHLAEEWGIDRVEADNIGTLGTI 80 
217959326   1 MRPYKRVLIKLSGGALADQTGNSFNSKRLEHIANEILSIVDLGIEVSIVIGGGNIFRGHLAEEWGIDRVEADNIGTLGTI 80 
218231216   1 MRPYKRVLIKLSGGALADQTGNSFNSKRLEHIANEILSIVDLGIEVSIVIGGGNIFRGHLAEEWGIDRVEADNIGTLGTI 80 
218896780   1 MRPYKRVLIKLSGGALADQTGNSFNSKRLEHIANEILSIVDLGIEVSIVIGGGNIFRGHLAEEWGIDRVEADNIGTLGTI 80 
222095470   1 MRPYKRVLIKLSGGALADQTGNSFNSKRLEHIANEILSIVDLGIEVSIVIGGGNIFRGHLAEEWGIDRVEADNIGTLGTI 80 
225863703   1 MRPYKRVLIKLSGGALADQTGNSFNSKRLEHIANEILSIVDLGIEVSIVIGGGNIFRGHLAEEWGIDRVEADNIGTLGTI 80 
118477269   1 MRPYKRVLIKLSGGALADQTGNSFNSKRLEHIANEILSIVDLGIEVSIVIGGGNIFRGHLAEEWGIDRVEADNIGTLGTI 80 
42780940    1 MRPYKRVLIKLSGGALADQTGNSFNSKRLEHIANEILSIVDLGIEVSIVIGGGNIFRGHLAEEWGIDRVEADNIGTLGTI 80 
30019882    1 MRPYKRVLIKLSGGALADQTGNSFNSKRLEHIANEILSIVDLGIEVSIVIGGGNIFRGHLAEEWGIDRVEADNIGTLGTI 80 
296502440   1 MRPYKRVLIKLSGGALADQAGNSFNSKRLEHIANEILSIVDLGIEVSIVIGGGNIFRGHLAEEWGIDRVEADNIGTLGTI 80 
163939648  81 INSLMLRGVLTSKTDREVRVMTSIPFNAVAEPYIRLRAVHHLDNGYVVIFGGGNGQPFVTTDYPSVQRAIEMNSDAILVA 160
217959326  81 INSLMLRGVLTSKTNKEVRVMTSIPFNAVAEPYIRLRAVHHLDNGYIVIFGGGNGQPFVTTDYPSVQRAIEMNSDAILVA 160
218231216  81 INSLMLRGVLTSKTNREVRVMTSIPFNAVAEPYIRLRAVHHLDNGYIVIFGGGNGQPFVTTDYPSVQRAIEMNSDAILVA 160
218896780  81 INSLMLRGVLTSKTNREVRVMTSIPFNAVAEPYIRLRAVHHLDNGYIVIFGGGNGQPFVTTDYPSVQRAIEMNSDAILVA 160
222095470  81 INSLMLRGVLTSKTNKEVRVMTSIPFNAVAEPYIRLRAVHHLDNGYIVIFGGGNGQPFVTTDYPSVQRAIEMNSDAILVA 160
225863703  81 INSLMLRGVLTSKTNKEVRVMTSIPFNAVAEPYIRLRAVHHLDNGYIVIFGGGNGQPFVTTDYPSVQRAIEMNSDAILVA 160
118477269  81 INSLMLRGVLTSKTNKEVRVMTSIPFNAVAEPYIRLRAVHHLDNGYIVIFGGGNGQPFVTTDYPSVQRAIEMNSDAILVA 160
42780940   81 INSLMLRGVLTSKTNTEVRVMTSIPFNAVAEPYIRLRAIHHLDNGYIVIFGGGNGQPFVTTDYPSVQRAIEMNSDAILVA 160
30019882   81 INSLMLRGVLTSKTNREVRVMTSIPFNAVAEPYIRLRAVHHLDNGYIVIFGGGNGQPFVTTDYPSVQRAIEMNSDAILVA 160
296502440  81 INSLMLRGVLTSKTNREVRVMTSIPFNAVAEPYIRLRAVHHLDNGYIVIFGGGNGQPFVTTDYPSVQRAIEMNSDAILVA 160
163939648 161 KQGVDGVFTSDPKHNKSAKMYSKLNYNDIVRQNIQVMDQAALLLARDYNLPAHVFNFDEPGVMKRICLGEHVGTLINDDV 240
217959326 161 KQGVDGVFTSDPKHNKAAKMYKKLNYNDIVRQNIQVMDQAALLLARDYNLPAHVFNFDEPGVMKRICLGEHVGTLINDDA 240
218231216 161 KQGVDGVFTSDPKHNKSAKMYSKLNYNDVVRQNIQVMDQAALLLARDYNLPAHVFNFDEPGVMKKICLGEHVGTLINDDV 240
218896780 161 KQGVDGVFTSDPKHNKSAKMYSKLNYNDVVRQNIQVMDQAALLLARDYNLPAHVFNFDEPGVMKRICLGEHVGTLINDDA 240
222095470 161 KQGVDGVFTSDPKHNKAAKMYKKLNYNDIVRQNIQVMDQAALLLARDYNLPAHVFNFDEPGVMKRICLGEHVGTLINDDA 240
225863703 161 KQGVDGVFTSDPKHNKAAKMYKKLNYNDIVRQNIQVMDQAALLLARDYNLPAHVFNFDEPGVMRRICLGEHVGTLINDDA 240
118477269 161 KQGVDGVFTSDPKHNKAAKMYKKLNYNDIVRQNIQVMDQAALLLARDYNLPAHVFNFDEPGVMRRICLGEHVGTLINDDA 240
42780940  161 KQGVDGVFTSDPKHNKAAKMYKKLNYNDIVRQNIQVMDQAALLLARDYNLPAHVFNFDEPGVMKRICLGEHVGTLINDDA 240
30019882  161 KQGVDGVFTSDPKHNKSAKMYSKLNYNDVVRQNIQVMDQAALLLARDYNLPAHVFNFDEPGVMKKICLGEHVGTLINDDV 240
296502440 161 KQGVDGVFTSDPKHNKSAKMYSKLNYNDVVRQNIQVMDQAALLLARDYNLPAHVFNFDEPGVMKKICLGEHVGTLINDDV 240
163939648 241 SMLVHEK 247
217959326 241 SLLVHEK 247
218231216 241 TMLVHEK 247
218896780 241 SLLVHEK 247
222095470 241 SLLVHEK 247
225863703 241 SLLAHEK 247
118477269 241 SLLAHEK 247
42780940  241 SLLVHEK 247
30019882  241 TMLVHEK 247
296502440 241 TMLVHEK 247
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap