Conserved Protein Domain Family
pyrH

?
PRK14556: pyrH 
UMP kinase
Statistics
?
PSSM-Id: 173021
View PSSM: PRK14556
Aligned: 9 rows
Threshold Bit Score: 452.566
Threshold Setting Gi: 167626816
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
56707468    1 MSNDSSECSQKLPKLKRILLKLSGESLSADQGFGINVESAQPIINQIKTLTNFGVELALVVGGGNILRGGRANFGNKIRR 80 
110669939   1 MSNDSSECSQKLPKLKRILLKLSGESLSADQGFGINVESAQPIINQIKTLTNFGVELALVVGGGNILRGGRANFGNKIRR 80 
115314161   1 MSNDSSECSQKLPKLKRILLKLSGESLSADQGFGINVESAQPIINQIKTLTNFGVELALVVGGGNILRGGRANFGNKIRR 80 
89255660    1 MSNDSSECSQKLPKLKRILLKLSGESLSADQGFGINVESAQPIINQIKTLTNFGVELALVVGGGNILRGGRANFGNKIRR 80 
156501610   1 MSNDSSECSQKLPKLKRILLKLSGESLSADQGFGINVESAQPIINQIKTLTNFGVELALVVGGGNILRGGRANFGNKIRR 80 
118496842   1 MSNDSSECSQKLPKLKRILLKLSGESLSADQGFGINVESAQPIINQIKTLTNFGVELALVVGGGNILRGGRANFGNKIRR 80 
134302595   1 MSNDSSECSQKLPKLKRILLKLSGESLSADQGFGINVESAQPIINQIKTLTNFGVELALVVGGGNILRGGRANFGNKIRR 80 
187932153   1 MSNDSSECSQKLPKLKRILLKLSGESLSADQGFGINVESAQPIINQIKTLTNFGVELALVVGGGNILRGGRANFGNKIRR 80 
167626816   1 MSNDSLECSQNTPKLKRVLLKLSGESLSADQGFGINVESAAPIINQIKTLVNLGVELAIVVGGGNILRGGRADFGDKIRR 80 
56707468   81 ATADSMGMIATMINALALRDMLISEGVDAEVFSAKGVDGLLKVASAHEFNQELAKGRVLIFAGGTGNPFVTTDTTASLRA 160
110669939  81 ATADSMGMIATMINALALRDMLISEGVDAEVFSAKGVDGLLKVASAHEFNQELAKGRVLIFAGGTGNPFVTTDTTASLRA 160
115314161  81 ATADSMGMIATMINALALRDMLISEGVDAEVFSAKGVDGLLKVASAHEFNQELAKGRVLIFAGGTGNPFVTTDTTASLRA 160
89255660   81 ATADSMGMIATMINALALRDMLISEGVDAEVFSAKGVDGLLKVASAHEFNQELAKGRVLIFAGGTGNPFVTTDTTASLRA 160
156501610  81 ATADSMGMIATMINALALRDMLISEGVDAEVFSAKGVDGLLKVASAHEFNQELAKGRVLIFAGGTGNPFVTTDTTASLRA 160
118496842  81 ATADSMGMIATMINALALRDMLISEGVDAEVFSAKGVDGLLKVASAHEFNQELAKGRVLIFAGGTGNPFVTTDTTASLRA 160
134302595  81 ATADSMGMIATMINALALRDMLISEGVDAEVFSAKGVDGLLKVASAHEFNQELAKGRVLIFAGGTGNPFVTTDTTASLRA 160
187932153  81 ATADSMGMIATMINALALRDMLISEGVDAEVFSAKGVDGLLKVASAHEFNQELAKGRVLIFAGGTGNPFVTTDTTASLRA 160
167626816  81 FTADSMGMIATMINALALRDMLISEDVDAEIFSAKGVDGLLRVASAHEFNRELAKGTVLIFAGGTGNPFVTTDSTASLRA 160
56707468  161 VEIGADALLKATTVNGVYDKDPNKYSDAKRFDKVTFSEVVSKELNVMDLGAFTQCRDFGIPIYVFDLTQPNALVDAVLDS 240
110669939 161 VEIGADALLKATTVNGVYDKDPNKYSDAKRFDKVTFSEVVSKELNVMDLGAFTQCRDFGIPIYVFDLTQPNALVDAVLDS 240
115314161 161 VEIGADALLKATTVNGVYDKDPNKYSDAKRFDKVTFSEVVSKELNVMDLGAFTQCRDFSIPIYVFDLTQPNALVDAVLDS 240
89255660  161 VEIGADALLKATTVNGVYDKDPNKYSDAKRFDKVTFSEVVSKELNVMDLGAFTQCRDFSIPIYVFDLTQPNALVDAVLDS 240
156501610 161 VEIGADALLKATTVNGVYDKDPNKYSDAKRFDKVTFSEVVSKELNVMDLGAFTQCRDFSIPIYVFDLTQPNALVDAVLDS 240
118496842 161 VEIGADALLKATTVNGVYDKDPNKYSDAKRFDKVTFSEVVSKELNVMDLGAFTQCRDFGIPIYVFDLTQPNALVDAVLDS 240
134302595 161 VEIGADALLKATTVNGVYDKDPNKYSDAKRFDKVTFSEVVSKELNVMDLGAFTQCRDFGIPIYVFDLTQPNALVDAVLDS 240
187932153 161 VEIGADALLKATTVNGVYDKDPNKYSDAKRFDKVTFSEVVSKELNVMDLGAFTQCRDFGIPIYVFDLTQPNALVDAVLDS 240
167626816 161 VEIGADALLKATTVDGVYDKDPNKYSDAKRFAKVTFSEVVSKELNVMDLGAFTQCRDFGIPIYVFDLTQPNALVDAVVDS 240
56707468  241 KYGTWVTLD 249
110669939 241 KYGTWVTLD 249
115314161 241 KYGTWVTLD 249
89255660  241 KYGTWVTLD 249
156501610 241 KYGTWVTLD 249
118496842 241 KYGTWVTLD 249
134302595 241 KYGTWVTLD 249
187932153 241 KYGTWVTLD 249
167626816 241 KHGTWVTLD 249
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap