Conserved Protein Domain Family
rnhB

?
PRK14550: rnhB 
ribonuclease HII; Provisional
Statistics
?
PSSM-Id: 173015
View PSSM: PRK14550
Aligned: 9 rows
Threshold Bit Score: 366.197
Threshold Setting Gi: 109946755
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15645936    6 MTLGIDEAGRGCLAGSLFVAGVACNEKTALEFLKMGLKDSKKLSLKKRFFLEYKIKTHGEVGFFVVKKSANEIDSLGLGA 85 
15612308    6 MTLGIDEAGRGCLAGSLFVAGVVCNEKIALEFLKMGLKDSKKLSPKKRFFLEDKIKTHGEVGFFVVKKSANEIDHLGLGA 85 
109946755   1 MTLGIDEAGRGCLVGSLFVAGVVCGEKIALDFLKMGLKDSKKLSQNKRFFLEDKIKSHDEVKFCVIKKSAGEIDSLSLGV 80 
108563693   1 MTLGIDEAGRGCLAGSLFVAGVACSEKTALEFLKMGLKDSKKLSQKKRFFLEDKIKTHGEVGFFVVKKSAEAIDSLGLGA 80 
188528111   1 MILGIDEAGRGCLAGSLFVAGVVCGEKTALEFLEMGLKDSKKLGPKKRFFLEDKIKTHGEIKFWVVKKSANEIDNLGLGA 80 
208435220   1 MILGIDEAGRGCLAGSLFVAGVACDDQTALEFLKMGLKDSKKLSPKKRFFLEDKIKTHGEVGFFVVKKSANEIDSLGLGA 80 
210135480   1 MILGIDEAGRGCLAGSLFVAGVACNDQTALELLKMGLKDSKKLSLKKRFFLEDKIKTHGKVKFFVVKKSANEIDNLGLGA 80 
254779865   1 MVLGIDEAGRGCLAGSLFVAGVVCSEKTALEFLKMGLKDSKKLSPKKRFFLEDKIKTHGEVGFFVVKKSANEIDSLGLGA 80 
298735652   1 MVLGIDEAGRGCLAGSLFVAGVACDEKTALEFLKMGLKDSKKLSPKKRFFLEDKIKTHGEVGFFVVKKSANEIDSLGLGA 80 
15645936   86 CLKLAVQEILENGCSLVDEIKIDGNTAFGLNKRYPHIQTIIKGDETIAQIAMASVLAKAFKDREMLELHALFKEYGWDKN 165
15612308   86 CLKLAIEEIVENGCSLANEIKIDGNTAFGLNKRYPNIQTIIKGDETIAQIAMASVLAKASKDREMLELHALFKEYGWDKN 165
109946755  81 CLKLAVQEILEKLSPLAQTINIDGNTAFGLNKRYSNLKTIIKGDEKIAQIAMASVLAKTSKDREMLELHALFKEYGWDKN 160
108563693  81 CLKLAIEEILENGCSLANEIKIDGNTAFGLNKRYPNIQTIIKGDETIAQIAMASVLAKAAKDREMLELHALFKEYGWDKN 160
188528111  81 CLKLAVQEILENGRSLANQIKIDGNTAFGLNKRYPNIQTIIKGDERIAQIAMASVLAKAFKDREMRQLHALFKEYGWDKN 160
208435220  81 CLKLAVQEILENGCSLANEIKIDGNTAFGLNKRYPNIQTIIKGDEKIAQIAMASVLAKAFKDREMRQLHALFKEYGWDKN 160
210135480  81 CLKLAIQEILENNRSLANEIKIDGNTAFGLNKRYPNIQTIIKGDETIAQIAMASVLAKAFKDREMLELHALFKEYGWDKN 160
254779865  81 CLKLAIQEILENGCSLANEIKIDGNTAFGLNKRYSNIQTIIKGDETIAQIAMASVLAKAAKDREMLELHALFKEYGWDKN 160
298735652  81 CLRLSIEEILENGCSLANEIKIDGNTAFGLNKRYPHIQTIIKGDEKIAQIAMASVLAKASKDREMRQLHALFKEYGWDKN 160
15645936  166 CGYGTKQHIEAIIKLGATPFHRHSFTLKNRILNPKLLEVEQRLI 209
15612308  166 CGYGTKQHIEAINKLGATPFHRHSFTLKNRILNPKLLEVEQRLV 209
109946755 161 CGYGTKKHIEAIAKLGATPFHRHSFALKNNWFS----------- 193
108563693 161 CGYGTKQHIEAIIKLGATPFHRHSFTLKNRILNPKLLEVEQRLV 204
188528111 161 CGYGTKQHIEAMIKLGATPFHRHSFTLKNRILNPKLLDVEQRLI 204
208435220 161 CGYGTKQHIEAISKLGATPFHRHSFTLKNRILNPKLLEVEQRLI 204
210135480 161 CGYGTKQHIEAITKLGATPFHRHSFTLKNCILNPKLLEVEQRLI 204
254779865 161 CGYGTKQHIEAMSKLGATPFHRHSFTLKNRTLNPKLLEVEQRLI 204
298735652 161 CGYGTKQHIEAIIKLGATPFHRRSFTLKNRIFNPKLLEVEQRLI 204
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap