Conserved Protein Domain Family
PRK14542

?
PRK14542: PRK14542 
nucleoside diphosphate kinase; Provisional
Links
?
Statistics
?
PSSM-Id: 173008
View PSSM: PRK14542
Aligned: 6 rows
Threshold Bit Score: 278.862
Threshold Setting Gi: 116327010
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
116327010   1 MSKTFIMIKPDGVKNKHVGNILARIEKEGFKILGLKYLKLSLEDAKQFYKVHSARPFYSDLCNYMSSGPIVAAALERDNA 80 
116332324   1 MSKTFIMIKPDGVKNKHVGNILARIEKEGFKILGLKYLKLSLEDAKQFYKVHSARPFYSDLCNYMSSGPIVAAALERDNA 80 
24216867    1 MSRTFIMIKPDGVKNKHVGNILSRIEKEGFKILGLKYLKLSLEDAKQFYKVHSARPFYNDLCNYMSSGPIVAAALERDNA 80 
45659145    1 MSRTFIMIKPDGVKNKHVGNILSRIEKEGFKILGLKYLKLSLEDAKQFYKVHSARPFYNDLCNYMSSGPIVAAALERDNA 80 
189909653   1 MERTFIMLKPDAVKNKHIGDILQRIEKEGFKILGMKFLKLSLEDAKQFYAVHAARPFYNDLCTYMASGPIVACALERDNA 80 
183219511   1 MERTFIMLKPDAVKNKHIGDILQRIEKEGFKILGMKFLKLSLEDAKQFYAVHAARPFYNDLCTYMASGPIVACALERDNA 80 
116327010  81 VLHWREVIGATDPKEAAAGTIRALYAESKEANAVHGSDSDENAALEVSFFFKGNELF 137
116332324  81 VLHWREVIGATDPKEAAAGTIRALYAESKEANAVHGSDSDENAALEVSFFFKGNELF 137
24216867   81 VLHWREVIGATDPKEAAAGTIRALYAESKEANAVHGSDSDDNAALEISFFFKGNELF 137
45659145   81 VLHWREVIGATDPKEAAAGTIRALYAESKEANAVHGSDSDDNAALEISFFFKGNELF 137
189909653  81 VAHWRDVIGATDPKEAKAGTIRALFAESKEANAVHGSDSVANALQEIAFFFKGYELN 137
183219511  81 VAHWRDVIGATDPKEAKAGTIRALFAESKEANAVHGSDSVANALQEIAFFFKGYELN 137
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap