Conserved Protein Domain Family
PRK14541

?
PRK14541: PRK14541 
nucleoside diphosphate kinase; Provisional
Statistics
?
PSSM-Id: 173007
View PSSM: PRK14541
Aligned: 11 rows
Threshold Bit Score: 268.354
Threshold Setting Gi: 193215152
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
193215152   1 MERTLAILKPDCVRKNLIGAAIEKIQSAGFKVVAMKMTRLTKETAGEFYAVHKARPFYGELVEFMSSGACVPLMLEKENA 80 
194335495   1 MERTLTILKPDCVRKQLIGAVIDQIERAGFRVVAMKKIRLTQETAGEFYAVHRERPFYGELVEFMSSGPCVPIILEKENA 80 
194334806   1 MERTLTILKPDCVRKQLIGAVIDKIERAGFRVVAMKKTKLTAQTAGEFYAVHSQRPFYGELVEFMSSGPCVPMILEKENA 80 
193211910   1 MERTLTILKPDCVRKQLIGAVTDKIERAGFRIVAMKKTRLTKETAGAFYAVHKERPFYGELVEFMSSGPCVPMILEKENA 80 
189501152   1 MERTLTILKPDCVRKQLIGAVIDKIERAGFRVVAMKKTKLTTETAGAFYAVHRERPFFGELVEFMSSGPCVPMILEKENA 80 
189347654   1 MERTLTILKPDCVRKQLIGAVIDKIERAGFRVVAMKKTRLTQETAGEFYAVHRERPFYGELVEFMSSGPCVPMILEKENA 80 
21674813    1 MERTLTILKPDCVRKQLIGAVTNMIERAGFRIVAMKKTRLTKETAGAFYAVHKERPFYGELVEFMSSGPCVPMILEKENA 80 
145219110   6 MERTLTILKPDCVKKQLIGAVINQIERAGFRVVAMKKIKLSKETAGEFYGVHRERPFFGELVDFMSSGPCVPMILEKENA 85 
119358136   1 MERTLTILKPDCVKKQLIGAVTDKIERAGFRIIAMKKTRLTKETAGEFYAVHRERPFYGELVEFMSSGPCVPMILEKENA 80 
78186117    1 MERTLTILKPDCVKKQLIGAVINQIERAGFRVVAMKKTRLTKETAGEFYAVHRERPFYGELVDFMSSGPCVPMILEKANA 80 
78188187    1 MERTLTILKPDCVRKQLIGAVINHIERAGFRVVAMKKIHLTKEAAGEFYAVHRERPFYGELVDFMSSGACVPMILEKENA 80 
193215152  81 VADFRTLIGATDPAEAAEGTIRKLYADSKGENIVHGSDSVENAKIECGFFFSTQEAVANM 140
194335495  81 VADFRTLIGATDPAQADAGTVRKLYADSKGENIVHGSDSEENAAIEAGFFFSAEEVVRSN 140
194334806  81 VADFRTLIGATDPAEAAEGTIRNLFADSKGENIIHGSDSAENAQIEAGFFFSTEEAVRVN 140
193211910  81 VADFRTLIGATDPAEAAEGTVRKLYADSKGENIVHGSDSAENAAIEGAFFFAAEEVVRVD 140
189501152  81 VEDFRKLIGATDPAEAEEGTVRKLYADSKGENIVHGSDSEENAQIESSFFFSTEEAVRVN 140
189347654  81 VADFRTLIGATDPAQADEGTVRKLYADSKGENIVHGSDSAENAAVEAGFFFSAEEVVRVD 140
21674813   81 VADFRTLIGATDPAQADEGTIRKLYADSKGENIIHGSDSAENAAIESAFFFAAEEVVRVD 140
145219110  86 VADFRTLIGATDPAEAEEGTVRKLHADSKGENIVHGSDSAENAAIEAGFFFAAEEVVRNN 145
119358136  81 VADFRTLIGATDPAEAAEGTVRKLYADSKGENIVHGSDSAENAAIEAGFFFSAEEVVRVN 140
78186117   81 VADFRTLIGATDPAEAAEGTVRKLYADSKGENIVHGSDSAENAAVEAGFFFAAEEVVRSN 140
78188187   81 VADFRTVIGATDPAEAAEGTVRKLYADSKGENIIHGSDSVENAAIEAAFFFSTEEVVRSN 140
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap