Conserved Protein Domain Family
PRK14538

?
PRK14538: PRK14538 
putative bifunctional signaling protein/50S ribosomal protein L9; Provisional
Statistics
?
PSSM-Id: 173004
View PSSM: PRK14538
Aligned: 5 rows
Threshold Bit Score: 1292.1
Threshold Setting Gi: 162447066
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
85057286    1 MFSKNKHNTKFIVIACVIVVLILILFCFDFQNIQEIIETINQLTNNqnpskntasemSGMRRKIIFFIFNFFGKIILASF 80 
39938498    9 MFSKNKHNTKFIVIACVIVVLILILFCLDFQNIQEIIETINQLTNNqnpsqntasemSGMRRKIIFFIFNFFGKIILASF 88 
197294286   1 ---MSLKKNVKLVMAIVIVVLFLLFLRYDYDNISKVIQQIDKTSDN-------------LLKARLWAAFG-LGKIILIIL 63 
194246575   2 FKKKINYKAIFILFCVIVIFILFVSLTMDLISINDKIKSIITGGET-----------SIKQVWTTFTTFSLLVKIFLLIL 70 
162447066   1 --------MRKLINGILITLWVIAFLVFTLVTFTEMFNQIP------------------NIKFISYMTFIVITLLAVFVL 54 
85057286   81 IISFLLHIKKNAQIKRLKNKLSLWSKLSFHVSQIGEEVLNELPIGIVLIDISSQEIQWLNPYASFILKNPEINSPLTQIN 160
39938498   89 VISFLLHIKKNAQIKRLKNKLSLWSKLSFHVSQIGEEVLNELPIGIVLIDISSQEIQWLNPYASFILKNPEINSPLAQIN 168
197294286  64 IISFVLQIKKNNKIKRLQAKLNLWSKLSFHVSQIGEEVLNELPIGIVLIDVNNKEIQWLNPYANLILKNPEINTPLSQIN 143
194246575  71 CIGFLLNFQNYFEINRLRNKLSLWSKLSYYVNQVGEEVFNKLPIGIVLIDDVEKGVQWLNPYANSILKNPIINTPLKNLN 150
162447066  55 ILTIVNNYKQY--IKNLQNRLARWSKLSPRVNQVGDDAFHELPIGILVLDEGLKEIKWVNQYAKVIFEGRLIDRPVAEIS 132
85057286  161 ENMAQLISTSDTIPKTIITLKNQKFECFYKKDLSVFYLFDATEKEQIKHLFLQKTLAIAMIAFDNLAESLIRYDLSEQSQ 240
39938498  169 ENMAQLISTSDAIPKTIITLENKKFECFYKKDLNVFYLFDATEKEQIKHLFLQKTLALAMITFDNLAESLIRYDLSEQSQ 248
197294286 144 ESM--LLLTEQETEKTIITLEKEKFECFYKKDLNVFYLFNASEKEEVKQLFRDKSLALAMITFDHLEESLIRYDISEQSQ 221
194246575 151 EEMEKLTNVSDN-NTTIINIDQEKFECLYKKEFNVFYLFNVTEKEQIKKLYYQKTPALSILSFDNLEESLVHYDLSEQTH 229
162447066 133 ASLADYLLSDNK-QPITISVKDQKYEVLYKDSFQVIYLFNVTSRENVKLEFIKNLPAIGILNLDNFEDNMTNFDISEQTS 211
85057286  241 IQGEYLSALSDYIEPYESYLKQLIDDRFLLLLNRQNLDKMLENKFSILDTIRNISHKYQLKVTLSMGIACWNLSYEKLAT 320
39938498  249 IQGEYLSALSDYIEPYEGYLKQLIDDRFLLLLNRQNLDKMLENKFIILDTIRNISYKYQLKVTLSMGIACWNLSYEKLAT 328
197294286 222 IKGEYLRALSDFIDPYEGYLKQLLDDRFLLLVNRQNLDKMIENKFSILDTVRKISHKYQLKVTLSMGIACWNVSYDKLAI 301
194246575 230 IQGQYLTVISEFAENYEGYLKKLFDNRFLLLINREKLEIIIKDKFSILEKVRNISNKYQLKITLSIGIACWNLSYDKLSS 309
162447066 212 IKGEYLSAIADWVDEYNGYLKPYGDNRMVMLIKRKRLEDMMAKKFDILEHIRDISTNYGIRVTLSIGIASWDLEYDELSD 291
85057286  321 YSQNAIELAQKRGGDQVVVNIENEKIKYFGAKIASLSKQSKVHARINAQNLVDILKKNPHCFIMGHTHTDLDALGSVIAF 400
39938498  329 YSQNAIELAQKRGGDQVVVNIENEKIKYFGAKIASLSKQSKVHARINAQNLVDILKKHPHCFIMGHTHTDLDALGSVIAF 408
197294286 302 YSQNAIELAQKRGGDQAVVNIENEKIQYFGAKIATLSKQSKVSVRVNTQNLVDIIKKYPGFYIMGHNYTDLDSLGSMIAF 381
194246575 310 YAQNAIELSQKRGGDQAVVNIENENIKFFGAKTDSFIKNSKVNVRVNAQILLDILNKNNDCFIMGHNNTDFDSLASMIAF 389
162447066 292 YAQNAIELAEKRGGDQAVVNIQNQKIAYFGAKLESITRSSRTNARLAAQMLGDTLNKADQIYIMGHDQTDLDSFGAMIGA 371
85057286  401 YKIAATIHPENNNYIILDEEKLDKSLIPVYHQLIKTESKKTLNIITTQQASKMIKDNSLIAVLDTQTKDMLNSPELLSLT 480
39938498  409 YKIATTIHPESNNYIILDEEKLDKSLIPVYNQLIKTEAKTSLNIITTQQASKMIKDNSLIAVLDTQTKDMVNSPELLSLT 488
197294286 382 YKIVLSLKPDCPNYIILDKEKLDKSLLPVYHQLIQQTTKPLVEIITTEKAAKMIDENDVIVVVDTQIKDTLNSPELLGLT 461
194246575 390 YRIASSINNSNKQYLIIDEDKLDPSVTFVYHKLIIQIPEIKNNIITTDQAKNLIQKNDTLAVLDTQSKEITNSPQLLSLT 469
162447066 372 LKMSLT-TPDIAAYLIVDMEKLDPTVTDVYNYLLSMNHLVTKHVITTQEALARKTKDTLLMILDTQNPQIVHSKELLDLK 450
85057286  481 PNIVVVDHHRATEEIIPSIFSYVESSASSTVELLVEVMGFLEKEVHITAFEASIMYAGILIDTNAFIYRTSSRTFEVASK 560
39938498  489 SNVVVVDHHRATEEIIPSIFSYVESSASSTVELLVEVMGFLEKEVHITAFEASIMYAGILIDTNAFIYRTSSRTFEVASK 568
197294286 462 NNVIVIDHHRATEEVVPSIFSYVDPSASSTVELLVEIMGFLTEEIKIAPFEASVMYAGILIDTNAFIYRTSSRTFEVILK 541
194246575 470 NNIIVIDHHRTPNDNIKSFFSYLNSSASSTVELMIELIRFLGKEITFTPFEASIMYAGILLDTNNFTYRTSSITFEVLAK 549
162447066 451 LKTAVIDHHRGNEASIKGDFSFIDPGASSTVELMMELFSFFPVEIQLDAPEASVMYGGIILDTNTFTYRTNARTFDVASK 530
85057286  561 LKDLGADAIEVKSWLRKDFDKVLEINKLISEMEIFMDRFAIIQSSEIYENRSFLAQVAESVLNIQNVDAAFMIAKIADNK 640
39938498  569 LKDLGADAIEVKSWLRKDFDKVLEINKLISEMEIFMDRFAIIQSSEIYENRSFLAQVAEGVLNIRNVDAAFMIAQIADNK 648
197294286 542 LKDFGADGIEVKSWLRKTRDNVDSTNALISKMEIFMGRFAIIKSDKIYDNRSFLAQVAEDALNISGIDAAFMVAKISNNR 621
194246575 550 LKDLGADSMEVKSWLRNDFIKILEINKLIDTMEIYMGRFAIVKSEQIYDNRSFLAQVSETVLDIQNIDAAFTFTKLNENT 629
162447066 531 LKDYGADTMMVKTWLRSDLNRIIKQNELLGKVEIFLDRFAIVKTEDVFNDRTFIAQLSESLLEIKNVDASFTIVNFSDGT 610
85057286  641 IAISARSYNEINVQTIMEQMEGGGHLNSAATQLEGTNIKTVTDTLKHFLK--LEYEKGEKNMEIILLTDISNKGKKHEII 718
39938498  649 IAISARSYNEINVQTIMEQMEGGGHLNSAATQLEGTNIKTVTDTLKHFLK--LEYEKGEKNMEIILLTDIPNKGKKHEII 726
197294286 622 IAISARSYNQVNVQTIMEQMEGGGHFNSAATQITGNDIQIVIQNLKRLLKleLEYEKGDAQMEIILLTDIPNKGKKHDII 701
194246575 630 IGISARSYNNVNVQILMEQFGGGGHLNSAATQIKGGNIEETVQKLKKLLK--LEYETG-VSMKIILLEDIKNKGLKGEMI 706
162447066 611 VGISARSFGAINVQLLMEEMGGGGHLSSAATQIKDVSVNDAYLQLKHILE--LEYGGDNTPMKVILLEDVKGKGKKDQVI 688
85057286  719 KVNNGYGNFLIQNKKALLADKANLAVIKQTQILEQEQKRNHELLMQKLKQEIDDKKITLDIQLGPKGKIYGKITLKQISE 798
39938498  727 KVNNGYGNFLIQNKKALLADKTNLAAIKQSQMLEQEQKRNHELLMHKLKQEIDDKKITLDIQLGPKGKIYGKITLKQIAE 806
197294286 702 KVNNGYGNFLIQSQKALLSDKNNLAQIRKNEILEKQKKANYEALMKKLKNEIDNKTISLDIQVGPKGKIYGKITLKQIAD 781
194246575 707 EVTPIYANFLIKSKKALLANNENIAKIKKEKNDEIEKKRNHEFLMSKLKSEIDNKKINIEVKLGPNGKIYGKVTSKRIVE 786
162447066 689 ELAGGYANYLISNKLAVFANEENIKKLEDKKEKEREEAAKYLELMKKVASEIEGKSITLSINVGADGKRFGSITTKQIVE 768
85057286  799 EFLKVHNITLDRKKISLESEIIAIGIYPVDVFLTDQIKATFFLNVTERKSK 849
39938498  807 EFLKVHNITLDRKKISLEGEIIAIGIYPVDVFLTDQIKATFFLNVTERKSK 857
197294286 782 EFKKIHHIIIDRKKISLENEITSVGIYHIDVNLTEQIKATFFLNVIERKNK 832
194246575 787 EFHKIYNILIDRKKICLDGEINSLGIYKIEVILTNEIKAYFLVNIIDDKMI 837
162447066 769 AFHEKHGVMIDKKRLELANDIGSVGIYPVTVSLDKGVKATFEVNIIERRD- 818
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap