Conserved Protein Domain Family
cysS

?
PRK14535: cysS 
cysteinyl-tRNA synthetase; Provisional
Statistics
?
PSSM-Id: 173001
View PSSM: PRK14535
Aligned: 5 rows
Threshold Bit Score: 982.669
Threshold Setting Gi: 254804107
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
218767348   1 MTTITEKRLTFAFPEDYYVTKYDEWEHYKIFQNSCNLRNKIDTNEKGKNGINQSVDDDNGSSGVDIIALHESTLWLIEIK 80 
161869111   1 MTTITEKRLTFAFPEDYYVTKYDEWEHYKIFQNSCNLRNKIDTNEKGKNGINQSVDDDNGSSGVDIIALHESTLWLIEIK 80 
15677904      --------------------------------------------------------------------------------    
121635739   1 MTTITEKRLTFAFPEDYYVTKYDEWEHYKIFQNSCNLRNKIDTNEKGKNGINQSVDDDNGSSGVDIIALHESTLWLIEIK 80 
254804107     --------------------------------------------------------------------------------    
218767348  81 DYYRLGLEPNAQSIDEKLSDLPYLIARKIRDSLAGLVSAKFKAEKQEEKDFSRLALDCNEIKIVLHIEMPSIRSKLYPSS 160
161869111  81 DYYRLGLEPNAQSIDEKLSDLPYLIARKIRDSLAGLVSAKFKAEKQEEKDFSRLALDCNEIKIVLHIEMPNIRSKLYPSS 160
15677904      --------------------------------------------------------------------------------    
121635739  81 DYYRLGLEPNAQSIDEKLSDLPYLIARKIRDSLAGLVSAKFKAAKQEEKDFSRLALDCNEIKIVLHIEMPSIRSKLYPSS 160
254804107     --------------------------------------------------------------------------------    
218767348 161 SDLANLLKDKFKLSEFTKNFANCYAEPIFTNISHINNPQLRNVPWSVSTGTEQKLSSEQQRLIHNPMTTIYNTLTRQKEP 240
161869111 161 SDLANLLKDKFKLSEFTKNFANCYAEPIFTNISHINNPQLRNVPWSVSTGTEQKLSSEQQRLIHNPMTTIYNTLTRQKEP 240
15677904    1 ------------------------------------------------------------------MTTIYNTLTRQKEP 14 
121635739 161 SDLANLLKDKFKLSEFTKNFANCYAEPIFTNISHINNPQLRNVPWSVSTGTEQKLSSEQQRLIHNPMTTIYNTLTRQKEP 240
254804107   1 ----------------------------------------------------------------MNMTTIYNTLTRQKEP 16 
218767348 241 FAPIDPKNVRMYVCGMTVYDYCHLGHARVMVVFDMIARWLRECGYPLTYVRNITDIDDKIIARAAENGETIGELTARFIQ 320
161869111 241 FAPIDPENVRMYVCGMTVYDYCHLGHARVMVVFDMIARWLRECGYPLTYVRNITDIDDKIIARAAENGETIGELTARFIQ 320
15677904   15 FSPIDPENVRMYVCGMTVYDYCHLGHARVMVVFDMIARWLRECGYPLTYVRNITDIDDKIIARAAENGETIGKLTARFIQ 94 
121635739 241 FAPIDPENVRMYVCGMTVYDYCHLGHARVMVVFDMIARWLRECGYPLTYVRNITDIDDKIIARAAENGETIGELTARFIQ 320
254804107  17 FAPIDPENVRMYVCGMTVYDYCHLGHARVMVVFDMIARWLRECGYPLTYVRNITDIDDKIIARAAENGETIGKLTARFIQ 96 
218767348 321 AMHEDADALGVLRPDIEPKATENIPQMIAMIETLIQNGKAYPAANGDVYYAVREFSAYGQLSGKSLDDLRAGERVEVDGF 400
161869111 321 AMHEDADALGVLRPDIEPKATENIPQMIAMIETLIQNGKAYPAANGDVYYAVREFAAYGQLSGKSLDDLRAGERVEVDGF 400
15677904   95 AMHEDADALGVLRPDIEPKATENIPQMIAMIETLIQNGKAYPAANGDVYYAVREFAAYGQLSGKSLDDLRAGERVEVDGF 174
121635739 321 AMHEDADALGVLRPDIEPKATENIPQMIAMIETLIQNGKAYPAANGDVYYAVREFAAYGQLSGKSLDDLRAGERVEVDGF 400
254804107  97 AMHEDADALGVLRPDIEPKATENIPQMIAMIETLIQNGKAYPAANGDVYYAVREFAAYGQLSGKSLDDLRAGERVEVDGF 176
218767348 401 KRDPLDFVLWKAAKAGEPAWESPWGNGRPGWHIECSAMSENLFGNTFDIHGGGADLQFPHHENEIAQSVGATGHTCGHHH 480
161869111 401 KRDPLDFVLWKAAKAGEPAWESPWGNGRPGWHIECSAMSENLFGDTFDIHGGGADLQFPHHENEIAQSVGATGHTCGHHH 480
15677904  175 KRDPLDFVLWKAAKAGEPAWESPWGNGRPGWHIECSAMSENLFGDTFDIHGGGADLQFPHHENEIAQSVGATGHTCGHHH 254
121635739 401 KRDPLDFVLWKAAKAGEPAWESPWGNGRPGWHIECSAMSENLFGDTFDIHGGGADLQFPHHENEIAQSVGASGHTCGHDH 480
254804107 177 KRDPLDFVLWKAAKAGEPAWESPWGNGRPGWHIECSAMSENLFGDTFDIHGGGADLQFPHHENEIAQSVGASGHTCGHDH 256
218767348 481 AQTHHGQSIASHVKYWLHNGFIRVDGEKMSKSLGNFFTIREVLKQYDPEVVRFFILRAHYRSPLNYSDAHLDDAKGALTR 560
161869111 481 AQTHHGQSIASHVKYWLHNGFIRVDGEKMSKSLGNFFTIREVLKQYDPEVVRFFILRAHYRSPLNYSDAHLDDAKGALTR 560
15677904  255 AQTHHGQSIASHVKYWLHNGFIRVDGEKMSKSLGNFFTIREVLKQYDPEVVRFFILRAHYRSPLNYSDAHLDDAKGALTR 334
121635739 481 AQTHHGQSIASHVKYWLHNGFIRVDGEKMSKSLGNFFTIREVLKQYDPEVVRFFILRAHYRSPLNYSDAHLDDAKGALTR 560
254804107 257 AQTHHGQSIASHVKYWLHNGFIRVDGEKMSKSLGNFFTIREVLKQYDPEVVRFFILRAHYRSPLNYSDAHLDDAKGALTR 336
218767348 561 LYTTLKNTPAAEFDLSENVNDYTRRFYAAMNDDFGTVEAVAVLFELAGEVNKTNDAQLAGCLKALGGIIGLLQRDPTEFL 640
161869111 561 LYTTLKNTPAAEFDLSENVNDYTRRFYAAMNDDFGTVEAVAVLFELAGEVNKTNDAQLAGCLKALGGIIGLLQRDPTEFL 640
15677904  335 LYTTLKNTPPADPMPSEAGDDYTRRFYVAMNDDFDTVKAVAVLFELAGEVNKTNDAQLAGRLKALGGIIGLLQRDPTEFL 414
121635739 561 LYTTLKNTPPADPMPSEADDDYTRRFYVAMNDDFDTVKAVAVLFELAGEVNKTNDAQLAGCLKALGGIIGLLQRDPTEFL 640
254804107 337 LYTTLKNTPAAEFGLSENANDYTRRFYAAMNDDFGTVEAVAVLFELAGEVNKTNDAHLAGCLKALGGIIGLLQRDPIEFL 416
218767348 641 QGGAASDGLSNEEIEDLIARRKQARADKNWAESDRIRDLLNEHKIILEDNAGGTTWRRG 699
161869111 641 QGGAASDGLSNEEIEDLIARRKQARSDKNWAESDRIRDLLNEHKIILEDNAGGTTWRRG 699
15677904  415 QGGAASDGLSNEEIEDLIARRKQARADKNWAESDRIRDLLNEHKIILEDNAGGTTWRRG 473
121635739 641 QGGAASDGLSNEEIEDLIARRKQARSDKNWAESDRIRDLLNEHKIILEDNAGGTTWRRG 699
254804107 417 QGGAVSDGLSNEEIDDLIARRKQARADKNWAESDRIRDLLNEHKIILEDNAGGTTWRRG 475
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap