Conserved Protein Domain Family
cysS

?
PRK14534: cysS 
cysteinyl-tRNA synthetase; Provisional
Statistics
?
PSSM-Id: 173000
View PSSM: PRK14534
Aligned: 8 rows
Threshold Bit Score: 896.904
Threshold Setting Gi: 203288037
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
119953383   1 MLLRLYNTKTKSLSEVKNFSDIKVYACGPTVYNYAHIGNFRTYIFEDLLIKSLRLLKYNVNYAMNITDIGHLTGEFDEGE 80 
111115428   1 MILKLHNTRTKDFSELTNFDNVKVYACGPTVYNYAHIGNFRTYIFGDLLIKTLRFLGYKVNYAMNITDIGHLTGDLDDGE 80 
15594944    1 MILKLYNTRTKDFSELTNFENVKVYACGPTVYNYAHIGNFRTYIFGDLLIKTLRFLGYKVNYAMNITDIGHLTGDLDDGE 80 
51598852    1 MILKLYNTRTKDFSELANFSDVKVYACGPTVYNYAHIGNFRTYIFGDLLIKTLRFLGYKVNYAMNITDIGHLTGDLDDGE 80 
203284503   5 MLLKLYNTKTKCLSEVKNLSETKIYACGPTVYNYAHIGNLRTYIFEDLLIKSLKLFKYNVNYAMNITDIGHLTGDFDDGE 84 
203288037   5 MLLKLYNTKTKCLSEVKNLSETKIYACGPTVYNYAHIGNLRTYIFEDLLIKSLKLFKYNVNYAMNITDIGHLTGDFDDGE 84 
187918460   1 MLLKLYNTKTKSLSDIKNFSDTKVYACGPTVYNYAHIGNLRTYIFEDLLIKSLRLLKYNVNYAMNITDIGHLTGDFDEGE 80 
218249402   1 MILKLYNTRTRDFSELTNFENVKVYACGPTVYNYAHIGNFRTYVFGDLLIKTLRFLGYKVNYAMNITDIGHLTGDLDDGE 80 
119953383  81 DKVVKAARERGLTVYEISRFFTEAFFCDCEKLNIVRPDKVLIASEYIASMIEVIKVLEQNGFTYFVNGNVYFDTSLFKSY 160
111115428  81 DKVVKTAREKGLTVQEISEFFTEAFFKDCRKLNVVYPDKVLIASKHIPIMIEVVKILEEKKITYFSNGNVYFDTSCFKSY 160
15594944   81 DKVAKTAREKGLTVYEISEFFTEAFFNDCRKLNIVYPDKVLVASKHIPIMIEVVKILEEKKITYFSNGNVYFDTSCFKSY 160
51598852   81 DKVAKTAREKGLTVYEISKFFTEAFFKDCKKLNVVYPDKVLIASKHIPNMIEVIKILEEKKFTYFSNGNVYFDTSCFKSY 160
203284503  85 DKVVKAAKERGLTVCEIGKFFTKAFFDDCKKLNILHPDKVLVASEYILDMIEVVKVLEKNGFTYFVNGNVYFDISRFKNY 164
203288037  85 DKVVKAAKERGLTVYDISRFFTKAFFDDCKKLNILYPDKVLVASEYILDMIEVVKVLEKNGFTYFVNGNVYFDISRFKNY 164
187918460  81 DKVVKAARERGLTVYEISRFFTEAFFDDCAKLNIVYPDKVLVASEYIASMIEVVKVLEQNGFTYFVNGNVYFDTSRFNGY 160
218249402  81 DKVAKTAREKGLTVYEISEFFTEAFFNDCRKLNIVYPDKVLVASKHIPIMIEVVKILEEKKITYFSNGNVYFDTSCFKSY 160
119953383 161 GQMAGINLNDfEFSSVSRVEVDPSKKNKSDFVLWFTNSKFKDQEMKWDSPWGFGYPSWHLECAAMNLDCFRSTLDIHLGG 240
111115428 161 GEMAGIDLID-KDMTFSRVDIDKFKRNKTDFVLWFTNSKFKDQEMKWDSPWGFGYPSWHLECAAMNLEYFKDTLDIHLGG 239
15594944  161 GEMAGIDLID-KDMTLPRVDVDKFKRNKTDFVLWFTNSKFKDQEMKWDSPWGFGYPSWHLECAAMNLEYFKDALDIHLGG 239
51598852  161 GEMAGIDLID-KDMAFSRVDIDKFKRNKTDFVLWFTNSKFKDQEMKWDSPWGFGYPSWHLECAAMNLEYFKDTLDIHLGG 239
203284503 165 GQMAGINLNDiNENSVSRVELDLSKRNKSDFVLWFTNSKFQNQEMKWDSPWGFGYPSWHLECATMNLNYFNSTLNIHLGG 244
203288037 165 GQMAGINLNDiNENSVSRVELDFSKRNKSDFVLWFTNSKFQNQEMKWDSPWGFGYPSWHLECATMNLNYFNSTLNIHLGG 244
187918460 161 GQMAGINLNNfGRSSVSRVEIDLSKKNKSDFVLWFTNSKFKDQEMKWDSPWGFGYPSWHLECAAMNLDYFKSTLDIHLGG 240
218249402 161 GEMAGIDLID-KDMTLPRVDVDKFKRNKTDFVLWFTNSKFKDQEMKWDSPWGFGYPSWHLECAAMNLEYFKDTLDIHLGG 239
119953383 241 VDHIGVHHINEIAIAECYLNRMWCDIFVHGEFLIMEDEKMSKSNNNFITIQDLETNGFSPLDFRYFCLTAHYRTQLKFTF 320
111115428 240 VDHIGVHHINEIAIVECFLNKKWCDIFVHGEFLIMDYNKMSKSRGNFITVKDLEEQNFSPLDFRYLCLTSHYRNQLKFSL 319
15594944  240 VDHIGVHHINEIAIAECFLNKKWCDVFVHGEFLIMDYNKMSKSRGNFITVKDLEDQNFSPLDFRYLCLTSHYRNQLKFSL 319
51598852  240 VDHIGVHHINEIAIVECFLNKKWCDIFVHGEFLIMDYNKMSKSHGNFITVKGLEEQNFSPLDFRYLCLTSHYRNQLKFSF 319
203284503 245 IDHIRVHHVNEIAIMECYLGKNWCDMFIHGEFLIMENEKMSKSNNDFITIKNLEDEGFSPLDFRYFCLTAHYRTQLKFTF 324
203288037 245 IDHIRVHHVNEIAIMECYLGKNWCDMFIHGEFLIMENEKMSKSNNDFITIKNLEDEGFSPLDFRYFCLTAHYRTQLKFTF 324
187918460 241 VDHVGVHHINEIAIAECYLNKMWCDMFVHGEFLIMEDEKMSKSNNNFITIKDLESDGFSPLDFRYFCLTAHYRTQLKFTF 320
218249402 240 VDHIGVHHINEIAIAECFLDNKWCDVFVHGEFLIMDYNKMSKSRGNFITVKDLEDQNFSPLDFRYLCLTSHYRNQLKFSL 319
119953383 321 NNLRACKVARKNMLNKLTAVFSSLNQFDLLLLSKNYENIESVLEKRYYDSFLEKIAFDLSIPQALALLWDIIKDDNLSAL 400
111115428 320 NNLQASKIARENMINRLSYFYASLDPVALGVLNKDLKNFGFSEEKEYYDSFIEKVSFDLNISQGLALLWEIIKSENLSFV 399
15594944  320 DNLQASKIARENLINKLSYFYESLDPVDLNTLNKDLKNFGFSVEKEYYDSFVEKISFDLNVAQGLALLWEIIKSDNLSFV 399
51598852  320 NNLKASKIARENMINRLSYFYASLDPADLNMLNKDLKNFGFSIEKEYYDSFVEKVSFDLNVSKGLALLWEVIKSENLGFV 399
203284503 325 HSLKACKVARENLLSKLTSCYSSLSQFDISLLSQDDENIEFILEHKYYDSFLERIAFDLNIPKVLALLWDIVRDNNLSSL 404
203288037 325 HSLKACKVARENLLSKLTSCYSSLSQFDISLLSQDDENIEFILEHKYYDSFLERIAFDLNIPKVLALLWDIVRDNNLSSL 404
187918460 321 SNLRACKIARENMLNKLTFFYSSLSQFDMALLNKNCENIESVSENKYYNNFLEKIAFDLSIPQALALLWDIVKDDDLSAL 400
218249402 320 DNLQASKIARENLINKLSYFYESLDPVDLNTLNKDLKNFGFSVEKEYYDSFVEKISFDLNVAQGLALLWEIIKSENLSFV 399
119953383 401 SKLRLTFKFDEVLSLGLKEGVFREIEKDRINIDDAMNSLLEERRLAKIRKDFKRADEIREYFYSKGFVLIDTEEGTKVKR 480
111115428 400 SKLRLAFIFDEIMSLNLREEILKNLENHDVVVDENMKTLIEERRIAKCEKNFKRADEIRDFFAKKGFVLVDTKEGTKVKR 479
15594944  400 SKLRLAFIFDEIMSLNLREEILKNLQNHDVVIDENMKALIEERRIAKCEKNFKRADEIRDFFAKKGFVLVDTKEGTKVKR 479
51598852  400 SKLKLAFIFDEIISLNLREEILKKSENHNIVIDENMKILLEERRIAKCEKNFKRADEIRDFFAKKGFVLIDTKEGTKVKR 479
203284503 405 AKLKLAFKFDEVLSLGLREEILREIDRSRIVIDDVMNSLIEERRLAKLKKDFKRADEIREYCRSKGFILIDTEEGTKVKR 484
203288037 405 SKLKLAFKFDEVLSLGLREEILREIDMSRIVIDDVMNSLIEERRLAKLKKDFKRADEIREYCRSKGFILIDTEEGTKVKR 484
187918460 401 LKLLLAFKFDEVLSLGLKEGVLREIERDRVNIDDTMHSLIEERRLAKLRKDFKRADEIREYFRSKGFVLIDTEEGTKVKR 480
218249402 400 SKLRLAFIFDEIMSLNLREEILKNLQNHDVVIDENMKALIEERRIAKCEKNFKRADEIRDFFAKKGFVLVDTKEGTKVKR 479
119953383 481 G 481
111115428 480 G 480
15594944  480 G 480
51598852  480 G 480
203284503 485 G 485
203288037 485 G 485
187918460 481 G 481
218249402 480 G 480
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap