Conserved Protein Domain Family
PRK14531

?
PRK14531: PRK14531 
adenylate kinase; Provisional
Statistics
?
PSSM-Id: 172997
View PSSM: PRK14531
Aligned: 8 rows
Threshold Bit Score: 311.36
Threshold Setting Gi: 148243234
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
33866618    1 MKSRLLFLGPPGAGKGTQAARLCNANGMSHLSTGDLLRSEVAAGTALGQEAEAVMNRGELVSDALVLAIVESQLKGlSSG 80 
33864018    1 MKQRLLFLGPPGAGKGTQAERLCAAHELMHLSTGDLLRTEVGAKTPLGQEAAAVMNRGELVSDELVLAIVENQLKN-QNG 79 
113955515   1 MKQRLLFLGPPGAGKGTQAALLCDRHGLRHLSTGDLLRAEVSAGSALGQEAESVMNRGELVSDSLVLAIVKAQLGAlNGQ 80 
78211909    1 MKNRLLFLGPPGAGKGTQAARLCDANSMKHLSTGDLLRSEVAAGSDLGKEAEAVMNRGELVSDALVLAIVESQMKAlTTD 80 
78185541    1 MKNRLLFLGPPGAGKGTQAARICDSNGMKHLSTGDLLRSEVAAGSELGKEAEAVMNRGELVSDQLVLAIVESQMKAlSGE 80 
124024015   1 MKQRLLFLGPPGAGKGTQAERLCAAHELMHLSTGDLLRAEVGAKTPLGQEAAAVMNRGELVSDELVLAIVENQLKN-QSG 79 
148243234   1 MSHRLLFVGPPGAGKGTQAERLAANHGLLHLSTGDLLRAEVKAGSELGKEAEAVMNRGELVSDALVLAIVRSRLQS-HSG 79 
148238751   1 MKQRLLFIGPPGAGKGTQASRLCETHGLRHLSTGDLLRSEVSAGSALGQEAEAVMNRGELVSDDLVLAIVRSQLTAlNGQ 80 
33866618   81 GWLLDGFPRTVPQADALEPLLDELKQPIEAVVLLELDDAVLIERLLARGRDDDNEAVIRNRLEVYREKTSPLISFYRDKG 160
33864018   80 GWLLDGFPRTLIQAKALEPLLEELKQPIEAVVLLELNDAVLIERLISRGRSDDNESVIRNRLEVYREKTAPLIDHYRQQG 159
113955515  81 GWLLDGFPRNVAQAEALDPLLQELNQPIEAVVLLELDDAVLIERLLSRGRDDDNEAVIRNRLVVYADKTEPLIEHYRQRG 160
78211909   81 GWLLDGFPRTVPQAEALEPLLAELQQPIQAVVLLELDDAVLIERLLARCRADDNEAVIRNRLEVYREKTSPLIRFYSDKG 160
78185541   81 GWLLDGFPRTVPQAEALEPLLNELKQPIEAVVLLELDDAVLITRMLSRGRADDNEDVIRNRLEVYRDKTAPLISYYQNKG 160
124024015  80 GWLLDGFPRTLIQATALEPLLEELKQPIEAVVLLELNDAVLIERLISRGRSDDNESVIRNRLEVYREKTAPLIDHYRQQG 159
148243234  80 GWLLDGFPRNLAQAEALDALLSELNQPLQSVLLMELDDDELVQRLLARGRADDNEEVIRHRLSVYREQTAPLINHYEQRG 159
148238751  81 GWLLDGFPRNVAQAEALEPLLGELQQSIETVVLLELDDEVLVERLLARGRADDNESVIRNRLEVYRQQTAPLIDYYQARG 160
33866618  161 LLVSVEANGSVEEITQRITKVLS 183
33864018  160 LLQTVEAHGSIESIAISIEKSLC 182
113955515 161 LLQSVEAHGSIEAITERIEGVLA 183
78211909  161 LLVSVPAQGTVEEITKRIDSILG 183
78185541  161 LLISVPAQGSVEEITERICKVLD 183
124024015 160 LLQTVEAQGSIESIAISIEKSLC 182
148243234 160 QLKRVVSTGTIEAVAEQITAALA 182
148238751 161 LLISVDAQGSVEAITTRLEASLA 183
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap