Conserved Protein Domain Family
PRK14528

?
PRK14528: PRK14528 
adenylate kinase; Provisional
Statistics
?
PSSM-Id: 172994
View PSSM: PRK14528
Aligned: 7 rows
Threshold Bit Score: 346.614
Threshold Setting Gi: 24213460
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
183221327   1 MKRLIFMGPPGAGKGTQADIIKEKYNIPQISTGDILRAAVKNGTAMGIEAKKYMDAGDLVPDAVVIGIIRDRLVEADCAN 80 
189911419   1 MKRLIFMGPPGAGKGTQADIIKEKYNIPQISTGDILRAAVKNGTAMGIEAKKYMDAGDLVPDAVVIGIIRDRLVEADCAN 80 
116332101   1 MKNIIFMGPPGAGKGTQAKILCARLSIPQISTGDILREAVKNQTPMGIEAKRYMDAGDLVPDSVVIGIIKDRIREADCKN 80 
116327245   1 MKNIIFMGPPGAGKGTQAKILCARLSIPQISTGDILREAVKNQTPMGIEAKRYMDAGDLVPDSVVIGIIKDRIREADCKN 80 
116327285   1 MKNIIFMGPPGAGKGTQAKILCARLSIPQISTGDILREAVKNQTPMGIEAKRYMDAGDLVPDSVVIGIIKDRIREADCKN 80 
24213460    1 MKNIIFMGPPGAGKGTQAKILCERLSIPQISTGDILREAVKNQTAMGIEAKRYMDAGDLVPDSVVIGIIKDRIREADCKN 80 
45658682    1 MKNIIFMGPPGAGKGTQAKILCERLSIPQISTGDILREAVKNQTAMGIEAKRYMDAGDLVPDSVVIGIIKDRIREADCKN 80 
183221327  81 GFILDGFPRTVEQAKALSEILKELHMELDSVVNLDVPDEELVKRLLGRAIKEGRSDDNEETIKNRLHTYNTKTLPLIDFY 160
189911419  81 GFILDGFPRTVEQAKALSEILKELHMELDSVVNLDVPDEELVKRLLGRAIKEGRSDDNEETIKNRLHTYNTKTLPLIDFY 160
116332101  81 GFLLDGFPRTVEQADALDALLKNEGKSIDKAINLEVPDGELLKRLLGRAEIEGRADDNEATIKNRLDNYNKKTLPLLDFY 160
116327245  81 GFLLDGFPRTVEQADALDALLKNEGKSIDKAINLEVPDGELLKRLLGRAEIEGRADDNEATIKNRLDNYNKKTLPLLDFY 160
116327285  81 GFLLDGFPRTVEQADALDALLKNEGKSIDKAINLEVPDGELLKRLLGRAEIEGRADDNEATIKNRLDNYNKKTLPLLDFY 160
24213460   81 GFLLDGFPRTVEQAEALDTLLKNEGKSIDKAINLQVPDAELLKRLLGRAEIEGRADDNEVTIKNRLDNYNKKTLPLLDFY 160
45658682   81 GFLLDGFPRTVEQAEALDTLLKNEGKSIDKAINLQVPDAELLKRLLGRAEIEGRADDNEVTIKNRLDNYNKKTLPLLDFY 160
183221327 161 KATGILRQINGLGSMEEITNTILKSI 186
189911419 161 KATGILRQINGLGSMEEITNTILKSI 186
116332101 161 AAQKKLSQVNGVGTLEEVTSLIQREL 186
116327245 161 AAQKKLSQVNGVGTLEEVTSLIQREL 186
116327285 161 AAQKKLSQVNGVGTLEEVTSLIQREL 186
24213460  161 ATRKKLSQVNGVGSLEEVTSLIQKEL 186
45658682  161 ATRKKLSQVNGVGSLEEVTSLIQKEL 186
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap