Conserved Protein Domain Family
PRK14526

?
PRK14526: PRK14526 
adenylate kinase; Provisional
Links
?
Statistics
?
PSSM-Id: 172992
View PSSM: PRK14526
Aligned: 8 rows
Threshold Bit Score: 344.912
Threshold Setting Gi: 111115245
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
218249221   1 MGLVFLGPPGSGKGTISKIISNEFKYQHISTGDLFRENILNSTALGQEIKKIVERGELVPDLITIKIVEDKIKAIKKNKD 80 
203287863   1 MKLVFLGPPGSGKGTIAKILSNELNYYHISTGDLFRTNIENDTPLGKEIKQIVENGQLVPDSITIKVVEDKINTIDNRDN 80 
203284327   1 MKLVFLGPPGSGKGTIAKILSNELNYYHISTGDLFRTNIENDTPLGKEIKQIVENGQLVPDSITIKVVEDKINTIDNRDN 80 
187918282   1 MKLVFLGPPGSGKGTIAKILSNKLNYYHISTGDLFRENISNATPLGKEIKQIVENGQLVPDSITIKIVEDKINTLENKDN 80 
111115245   1 MELVFLGPPGSGKGTISKIISNEFQYYHISTGDLFRENILNSTTLGKEIKKIVEKGELVPDLITIKIVEDKIKSIKKNKN 80 
119953206   1 MKLVFLGPPGSGKGTIAKILSGKLNYYHISTGDLFRANISNATPLGKEIKQIVENGQLVPDSITIKIVEDKINTLANKDN 80 
15594762    1 MGLVFLGPPGSGKGTISKIISNEFKYQHISTGDLFRENILNSTALGQEIKKIVERGELVPDLITIKIVEDKIKAIKKNKD 80 
51598674    1 MGLVFLGPPGSGKGTISKIISNEFKYHHISTGDLFRENILNSTTLGKEIKKIVEKGELVPDQITIKIVKDKIKAIKKNDN 80 
218249221  81 FILDGFPRNICQAEALDKFLPNVKIINFLIDEELVIKRLSGRRICKSCNNIFNIYTLTTKKNGICDVCGGDLYQREDDKE 160
203287863  81 FILDGFPRNINQAIELDRLLENIKIINFLINEKLLVKRLSGRRICQSCCKIFNIYTLPTKEKEICDFCQGILYQRKDDTK 160
203284327  81 FILDGFPRNINQAIELDRLLENIKIINFLIDEKLLVKRLSGRRICQSCCKIFNIYTLPTKEKEICDFCQGILYQRKDDTK 160
187918282  81 FILDGFPRNINQAKALDKFLKNIQIINFLLDEEILIKRLSGRRICKSCGGIFNIYTLPTKEKEICDLCKGILYQRKDDTE 160
111115245  81 FILDGFPRNICQAKALDKFLPNVKIINFLIDEESVIKRLSGRRICKSCNNIFNIHTLATKNIGICDVCGGDLYQREDDKE 160
119953206  81 FILDGFPRNINQAKALDTFLQNIQIINFLLDEAILIKRLSGRRICQSCGGIFNIYTLPTKEKGICDLCKGSLYQRKDDVE 160
15594762   81 FILDGFPRNICQAEALDKFLPNVKIINFLIDEELVIKRLSGRRICKSCNNIFNIYTLTTKKNGICDVCGGDLYQREDDKE 160
51598674   81 FILDGFPRNICQAEALDKFLPNVKIINFLINEELVIKRLSGRRICKSCNNIFNIYTLATKKNGICDVCKGDLYQREDDKE 160
218249221 161 ECLKTRLKEYKLQTKPLIEFYSKCSRLNNVDASVKIDEIKKKIIKIMLKKN 211
203287863 161 ESLKIRLQEYNLQTKPLINFYSNSNRLNNIDASKNINEVQKNLMEIISKIE 211
203284327 161 ESLKIRLQEYNLQTKPLINFYSNSNRLNNIDASKNINEVQKNLMEIISKIE 211
187918282 161 GSLKVRLQEYHLQTKPLTDFYSKSNRLNNINASKDIDEVEKSLMEIISKS- 210
111115245 161 ECLKTRLKEYKLQTKPLIEFYSKCSRINNVDASVTIDEVRKKIIKIMLKKN 211
119953206 161 ESLKIRLQEYHLQTKPLIDFYSKNNRLNNINASKDIDGVEKSLIEIISKY- 210
15594762  161 ECLKTRLKEYKLQTKPLIEFYSKCSRLNNVDASVKIDEIKKKIIKIMLKKN 211
51598674  161 ECLKTRLKEYKLQTKPLIEFYSKCSRLNNVDASVEIDEIKKKIIKIMLKKN 211
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap