Conserved Protein Domain Family
rpsP

?
PRK14525: rpsP 
30S ribosomal protein S16; Provisional
Statistics
?
PSSM-Id: 172991
View PSSM: PRK14525
Aligned: 5 rows
Threshold Bit Score: 157.856
Threshold Setting Gi: 108759661
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
153004803  1 MAVVLRLSRAGTHKAPFYHVVATDSRNARDGKYIEDVGIYDPTQQPERIELKAERIEHWLKVGATPSQTVAMILKRAKKT 80 
86158339   1 MAVVLRLSRAGTHKAPFYHVVATDSRNARDGKYLEDVGIYDPTKRPERIELKVERIEHWLKAGAKPSQTVAMILKRAAKA 80 
108759661  1 MAVVLRLARAGVKKKPYYHVVATDSRNPRDGKFIEAVGAYDPNQEPPKVEFNEERLNYWLKTGATPSETVADLIKVAGKA 80 
197122369  1 MAVVLRLSRAGTHKAPFYHVVATDSRNARDGKYLEDVGIYDPTKRPERIELKVERIEHWLKAGAKPSQTVAMILKRAAKA 80 
220917151  1 MAVVLRLSRAGTHKAPFYHVVATDSRNARDGKYLEDVGIYDPTKRPERIELKVERIEHWLKAGAKPSQTVAMILKRAAKA 80 
153004803 81 AQPAEKKA 88 
86158339  81 AAPAAPKA 88 
108759661 81 KPAPAV-- 86 
197122369 81 AAPVAPKA 88 
220917151 81 AAPAAPKA 88 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap