Conserved Protein Domain Family
rpsP

?
PRK14524: rpsP 
30S ribosomal protein S16; Provisional
Statistics
?
PSSM-Id: 172990
View PSSM: PRK14524
Aligned: 9 rows
Threshold Bit Score: 150.406
Threshold Setting Gi: 154249333
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
217076197  1 MVRIRLTRMGKKKQPFYRIVVVDQRKRRDGAYIESLGYYDPIKDPyILNVDVDKAVEWIMKGAQPSDTVRNLLRKAGVFK 80 
170289018  1 MVRIRLTRMGKRHQPFYRIVVVDSRKRRDGAYIESLGYYNPLKEG-EIKIDVERAVEWILKGAQPSDTVRDIFRKFGVMK 79 
222100123  1 MVRIRLTRMGKRKQPFYRIVVVDSRKRRDGAYIESLGYYNPLKEG-EIKIDVERAVDWILKGAQPSDTVRDIFKKFGVMK 79 
150021671  1 MVRIRLTRMGKKKQPFYRIVVVDQRKRRDGAYIESLGYYDPIKDPyILNVDVDKAVDWILKGAQPSQTVKNLLRKAGVFK 80 
148270356  1 MVRIRLTRMGKRHQPFYRIVVVDSRKRRDGAYIESLGYYNPLKEG-EIKIDVERAVEWILKGAQPSDTVRDIFRKFGVMK 79 
154249333  1 MVRIRLTRMGKKKQPFYRIVVVDQKKKRDGAYVESLGYYNPLKEPyEVKVDIDRAVEWMLKGAQPSETVSKLLGKLGLYE 80 
157362995  1 MVRIRLTRMGKRHMPFYRIVVVDSRKRRDGAYIESLGYYNPLRKPaEIKVNVERAVEWILKGAQPSETAANILSKAGVLA 80 
15644314   1 MVRIRLTRMGKRHQPFYRIVVVDSRKRRDGAYIESLGYYNPLKEG-EIKIDVERAVEWILKGAQPSDTVRDIFRKFGVMK 79 
281412662  1 MVRIRLTRMGKRHQPFYRIVVVDSRKRRDGAYIESLGYYNPLKEG-EIKIDVERAVEWILKGAQPSDTVRDIFRKFGVMK 79 
217076197 81 KVDELKRTKKEENK 94 
170289018 80 RVHEIKYGKKEEAT 93 
222100123 80 RVHEIKYGKKEEAT 93 
150021671 81 KVDEIKRTKKKEEN 94 
148270356 80 RVHEIKYGKKEEAT 93 
154249333 81 KLEEAKSKKA---- 90 
157362995 81 KVHEMKYGKREKSD 94 
15644314  80 RVHEIKYGKKEEAT 93 
281412662 80 RVHEIKYGKKEEAT 93 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap