Conserved Protein Domain Family
rpsP

?
PRK14523: rpsP 
30S ribosomal protein S16; Provisional
Statistics
?
PSSM-Id: 172989
View PSSM: PRK14523
Aligned: 5 rows
Threshold Bit Score: 223.945
Threshold Setting Gi: 161830775
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
161830775   1 MVVIRLARGGSKKNPFYHIVVADRRKPRDGRFIERVGYYNPMARGQDIRLQLEKERISHWLNQGAQTSLRVKHLIKKLEK 80 
209364130  45 MVVIRLARGGSKKNPFYHIVVADRRKPRDGRFIERVGYYNPMARGQDIRLQLEKERISHWLNQGAQTSLRVKHLIKKLEK 124
215918967  45 MVVIRLARGGSKKNPFYHIVVADRRKPRDGRFIERVGYYNPMARGQDIRLQLEKERISHWLNQGAQTSLRVKHLIKKLEK 124
212218945  45 MVVIRLARGGSKKNPFYHIVVADRRKPRDGRFIERVGYYNPMARGQDIRLQLEKERISHWLNQGAQTSLRVKHLIKKLEK 124
212213069  45 MVVIRLARGGSKKNPFYHIVVADRRKPRDGRFIERVGYYNPMARGQDIRLQLEKERISHWLNQGAQTSLRVKHLIKKLEK 124
161830775  81 SPEEAQKGGMRKGEFKRLQAEQAAKAQKKAVATEEPKAEEAKEAPPAESQAAEGKEE 137
209364130 125 SPEEAQKGGMRKGEFKRLQAEQAAKAQKKAVATEEPKAEEAKEAPPAESQAAEGKEE 181
215918967 125 SPEEAQKGGMRKGEFKRLQAEQAAKAQKKAVATEEPKAEEAKEAPPAESQAAEGKEE 181
212218945 125 SPEEAQKGGMRKGEFKRLQAEQAAKAQKKAVATEEPKAEEAKEAPPAESQAAEGKEE 181
212213069 125 SPEEAQKGGMRKGEFKRLQAEQAAKAQKKAVATEEPKAEEAKEAPPAESQAAEGKEE 181
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap