Conserved Protein Domain Family
rpsP

?
PRK14522: rpsP 
30S ribosomal protein S16; Provisional
Statistics
?
PSSM-Id: 172988
View PSSM: PRK14522
Aligned: 14 rows
Threshold Bit Score: 180.191
Threshold Setting Gi: 15834915
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
166155122   1 MALKIRLRQQGRKNHVVYRLVLADVESPRDGKYIELLGWYDPHSEQNYQLKSERIFYWLNQGAELTEKAGALVKQGAPGV 80 
166154247   1 MALKIRLRQQGRKNHVVYRLVLADVESPRDGKYIELLGWYDPHSEQNYQLKSERIFYWLNQGAELTEKAGALVKQGAPGV 80 
33241452    1 MALKIRLRQQGRRNHVVYRLVLADVESPRDGKYIELLGWYDPHSSINYQLKSERIFYWLERGAQLSSKAEALVKQGAPGV 80 
29840415    1 MALKIRLRQQGRRNHVVYRLVLADVESPRDGRYIELLGWYDPHSAVNYQLKGDRIFHWLSQGAELTEKAAVLIKQGAPGV 80 
62185240    1 MALKIRLRQQGRRNHVVYRLVLADVESPRDGRYIELLGWYDPHSTVNYQLKSDRIFHWLNQGAELTEKAAILIKQGAPGV 80 
15835652    1 MALKIRLRQQGRRNHVVYRLVLADVESPRDGKYIELLGWYDPHSSINYQLKSERIFYWLERGAQLSSKAEALVKQGAPGV 80 
16752928    1 MALKIRLRQQGRRNHVVYRLVLADVESPRDGKYIELLGWYDPHSSINYQLKSERIFYWLERGAQLSSKAEALVKQGAPGV 80 
15604744    1 MALKIRLRQQGRKNHVVYRLVLADVESPRDGKYIELLGWYDPHSEQNYQLKSERIFYWLNQGAELTEKAGALVKQGAPGV 80 
89898161    1 MALKIRLRQQGRRNHVVYRLVLADVESPRDGRYIELLGWYDPHSTVNYQLKSERIFHWLNQGAELTEKAAVLIKQGAPGV 80 
76788738    1 MALKIRLRQQGCKNHVVYRLVLADVESPRDGKYIELLGWYDPHSEQNYQLKSERIFYWLNQGAELTEKAGALVKQGAPGV 80 
166155122  81 YAELMAKKVARRAVVRQKRRAYRQRLAARKAEAAAK 116
166154247  81 YAELMAKKVARRAVVRQKRRAYRQRLAARKAEAAAK 116
33241452   81 YSALLSKQEARKLVVRKKRRAYRQRRSTQREEAAKD 116
29840415   81 YSELMAKQAARKAAVCQKRRAYRQRRSLKRAEAAKA 116
62185240   81 YCELMAKRMARKAAVCQKRRAYRQRRSLKRAEAKQS 116
15835652   81 YSALLSKQEARKLVVRKKRRAYRQRRSTQREEAAKD 116
16752928   81 YSALLSKQEARKLVVRKKRRAYRQRRSTQREEAAKD 116
15604744   81 YAELMAKKVARRAVVRQKRRAYRQRLAARKAEAAAK 116
89898161   81 YSELMAKKMTRKAVMCQKRRAYRQRRSLKRAETAQA 116
76788738   81 YAELMAKKVARRAVVRQKRRAYRQRLAARKAEAAAK 116
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap