Conserved Protein Domain Family
PRK14505

?
PRK14505: PRK14505 
bifunctional photosynthetic reaction center subunit L/M; Provisional
Statistics
?
PSSM-Id: 172976
View PSSM: PRK14505
Aligned: 2 rows
Threshold Bit Score: 1175.6
Threshold Setting Gi: 156743683
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
148657374   1 MSAVPRALPLPSGETLPAEAISSTGSQAASAEVIPFSIIEEFYKRPGKTLAARFFGVDPFDFWIGRFYVGLFGAISIVGI 80 
156743683   1 MSAVPRALPLPSGETLPAEAISSTGSQAASAEVIPFSIIEEFYKRPGKTLAARFFGVDPFDFWIGRFYVGLFGAISIIGI 80 
148657374  81 VLGVAFYLYEGVVNEGTFNILAMRIEPPPVSEGFNISPGKPGFFWFLTMVSATIAFIGWLLRQIDISLKLDMGMEVPIAF 160
156743683  81 ILGVAFYLYEGVVNEGTLNILAMRIEPPPVSQGLNVDPAQPGFFWFLTMVAATIAFVGWLLRQIDISLKLDMGMEVPIAF 160
148657374 161 GAVVSSWITLQWLRPIAMGGWGHGFPLGITHHLDWVSNIGYQYYNFFYNPFHAIGITLLFASTLFLHMHGSAVLSEARRN 240
156743683 161 GAVVSSWITLQWLRPIAMGAWGHGFPLGITHHLDWVSNIGYQYYNFFYNPFHAIGITLLFASTLFLHMHGSAVLSEAKRN 240
148657374 241 ISDQNIHVFWRNILGYSIGEIGIHRVAFWTGAASVLFSNLCIFLSGTFVKDWNAFWGFWDRMPIWNGIGQGALAAGLALM 320
156743683 241 ISDQNIHVFWRNILGYSIGEIGIHRVAFWTGAASVLFSNLCIFLSGTFVKDWNAFWGFWDKMPIWNGVGQGALVAGLSLL 320
148657374 321 GVGLVLGRARETPEPVDLRDEEYRDGLEGTIAKPPGHVGWMQRLLGEGQVGPIYVGLWGVISFITFFASAFIILVDYGRQ 400
156743683 321 GVGLVLGRGRETPGPIDLHDEEYRDGLEGTIAKPPGHVGWMQRLLGEGQVGPIYVGLWGVISFITFFASAFIILVDYGRQ 400
148657374 401 VEWNAVIYLREFWNLAVYPPPTEYGLSWNVPWDKGGAWLAATFFLHLSVLTWWARLYTRAKATRIGTHLAWGFASALSLY 480
156743683 401 VGWNPIIYLREFWNLAVYPPPTEYGLSWNVPWDKGGAWLAATFFLHISVLTWWARLYTRAKATGVGTQLAWGFASALSLY 480
148657374 481 FVIYLFHPLALGNWSAAPGHGFRAILDWTNYVSIHWGNFYYNPFHMLSIFFLLGSTLLLAMHGATIVATSKWKSEMEFTE 560
156743683 481 FVIYLFHPLALGNWSAAPGHGFRAILDWTNYVSIHWGNFYYNPFHMLSIFFLLGSTLLLAMHGATIVATSKWKSEMEFTE 560
148657374 561 MMAEGPGTQRAQLFWRWVMGWNANSYNIHIWAWWFAALTAITGAIGLFLSGTVIPDWYTWGESIKIVAPMPPLEywWQQF 640
156743683 561 MMAEGPGTQRAQLFWRWVMGWNANSYNIHIWAWWFAAFTAITGAIGLFLSGTLVPDWYAWGETAKIVAPWPNPD--WAQY 638
148657374 641 IFR 643
156743683 639 VFR 641
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap