Conserved Protein Domain Family
PRK14497

?
PRK14497: PRK14497 
putative molybdopterin biosynthesis protein MoeA/unknown domain fusion protein; Provisional
Statistics
?
PSSM-Id: 172968
View PSSM: PRK14497
Aligned: 11 rows
Threshold Bit Score: 876.06
Threshold Setting Gi: 15920721
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
229583195   1 MRVFVGDESLYSIDEAIKVYLSSLNFTP-KIVKVEVKDSFGYVSAEDLMSPIDYPPFSRSNVDGYALKSSCTPGELKVID 79 
229583737   1 MRVFVGDESLYSIDEAIKVYLSSLNFTP-KIVKVEVKDSFGYVSAEDLMSPIDYPPFSRSNVDGYALKSSCTPGELKVID 79 
229577984   1 MRVFVGDESLYSIDEAIKVYLSSLNFTP-KIVKVEVKDSFGYVSAEDLMSPIDYPPFSRSNVDGYALKSSCTPGELKVID 79 
227826573   1 MRVFVGDESLYSIDEAIKVYLSSLNFTP-KIVKVEVKDSFGYVSAEDLMSPIDYPPFSRSNVDGYALKSSCTPGELKVID 79 
227829215   1 MRVFVGDESLYSIDEAIKVYLSSLNFTP-KIVKVEVKDSFGYVSAEDLMSPIDYPPFSRSNVDGYALKSSCTPGELKVID 79 
70606758    1 MRAILKDSELLYPQDALAKFLNEFGVKQlEVERINLEDSLNRIVAEDIISDIPLPPFSRSTVDGFAIKHDLCPGEFTVID 80 
146303454   1 MRNFVPEENLPTPLEAIEKFLRTLPPKR-RTISLGILDSVGKITSSSVRAKTDYPPFSRSTVDGFAVKSSSTPGRFRIVG 79 
15899122    5 MRVFVKDELLYSIEEAIRVYLSSLNFIP-KTVEVEVKDSFGYVSAEDLNSPIDYPPFSRSNVDGYALKSSCTPGELKVID 83 
15920721    1 MRAILDDKNLLLAEDALRIFINETSPKPiGVEEVDILDSLNRVSAEYVFSPIDLPPFSRSTVDGYAIIDSETPGEFTVID 80 
238618659   1 MRVFVGDESLYSIDEAIKVYLSSLNFTP-KIVKVEVKDSFGYVSAEDLMSPIDYPPFSRSNVDGYALKSSCTPGELKVID 79 
284996570   1 MRVFVGDESLYSIDEAIKVYLSSLNFTP-KIVKVEVKDSFGYVSAEDLMSPIDYPPFSRSNVDGYALKSSCTPGELKVID 79 
229583195  80 RIGIGEFKEIHIKECVAVEVDTGAMIPMGADAVIKVENVKVINGNSIKIDKKINFGQNIGWIGSDIPKNSIILRKGEVIS 159
229583737  80 RIGIGEFKEIHIKECVAVEVDTGAMIPMGADAVIKVENVKLINGNFIKIDKKINFGQNIGWIGSDIPKNSIILRKGEVIS 159
229577984  80 RIGIGEFKEIHIKECVAVEVDTGAMIPMGADAVIKVENVKVINGNSIKIDKKINFGQNIGWIGSDIPKNSIILRKGEVIS 159
227826573  80 RIGIGEFKEIHIKECVAVEVDTGAMIPMGADAVIKVENVKLINGNFIKIDKKINFGQNIGWIGSDIPKNSIILRKGEVIS 159
227829215  80 KIGIGEFKEIHIKECVAVEVDTGAMIPMGADAVIKVENVKVINGNSIKIDKKINFGQNIGWIGSDIPKNSIILRKGEVIS 159
70606758   81 KIRIGEFKEIRIGNGEAVEVDTGSPIPEGATAVVKVENT-VIEGNKVKVSKKLSFGENIGWIGTDIPKGTLVVRRGERLN 159
146303454  80 KISIGEWKDITIGPGEAVEVDTGSPLPWGADAVVKIEDTHV-ELPFVEINSRLRFGANVAWAGSDISKGSEIIGEFQEIT 158
15899122   84 RIEIGEFKEVHINECVAVEVDTGAIIPMGADAVIKVEDVKIISGNLIKVDKKMTFGQNIGWIGSDIPKNSIILRKGEVIS 163
15920721   81 KISIGEYKEIEIKDKEAVEVDTGSIIPENATAVIKVEETER-KGDKIFVGRKVRFGENIGFIGSDIPKGFEILKPGEIIK 159
238618659  80 RIGIGEFKEIHIKECVAVEVDTGAMIPMGADAVIKVENVKLINGNFIKIDKKINFGQNIGWIGSDIPKNSIILRKGEVIS 159
284996570  80 RIGIGEFKEIHIKECVAVEVDTGAMIPMGADAVIKVENVKVINGNSIKIDKKINFGQNIGWIGSDIPKNSIILRKGEVIS 159
229583195 160 HEKIGLLASLGISSVKVYEKLKIYLIATGDELVEPGNSLSPGKIYESNLHYLYSKLK-ENYKIVGLSLLSDDIRSIKNEI 238
229583737 160 HEKIGLLASLGISSIKVYEKLKIYLIATGDELVEPGNSLSPGKIYESNLHYLYSKLK-ENYKIVGLSLLSDDIRSIKNEI 238
229577984 160 HEKIGLLASLGISSVKVYEKLKIYLIATGDELVEPGNSLSPGKIYESNLHYLYSKLK-ENYKIVGLSLLSDDIRSIKNEI 238
227826573 160 HEKIGLLASLGISSIKVYEKLKIYLIATGDELVEPGNSLSPGKIYESNLHYLYSKLK-ENYKIVGLSLLSDDIRSIKNEI 238
227829215 160 HEKIGLLASLGISSVKVYEKLKIYLIATGDELVEPGDSLSPGKIYESNLHYLYSKLK-ENYKIVGLSLLSDDISSIKNEI 238
70606758  160 PYKIALLASIGIRQVLVYKRPRIYIIITGDELVEPGKDLDPGKIYESNSYYLQAYYLsKGYDVIKRTHVNDDKELIRREI 239
146303454 159 PEDVGAFASVGIETVEVYDLPKVYVIATGDELVQPGRDLTPGKIYESNVHFLVSRLKqLGCEIVGAEVLPDDKEKIRNSL 238
15899122  164 HEKIGLLASLGISKVKVYEKLKVYLIATGDELVEPGNSLSPGKIYESNLHYLYSKLK-QNYQIVGLSLLRDDIESIKNEI 242
15920721  160 AEKIALLASVGITKVKVFKRPKIYIITTGDELIEPGKPLQKGKIYESNSFYLYAKLKsEGYEIIGYTHVRDDKELIKEEL 239
238618659 160 HEKIGLLASLGISSIKVYEKLKIYLIATGDELVEPGNSLSPGKIYESNLHYLYSKLK-ENYKIVGLSLLSDDIRSIKNEI 238
284996570 160 HEKIGLLASLGISSVKVYEKLKIYLIATGDELVEPGDSLSPGKIYESNLHYLYSKLK-ENYKIVGLSLLSDDIRSIKNEI 238
229583195 239 KRAISVTDVLILTGGTSAGEKDFVHRAVRELGNIIVHGIKIKPGKPTILGIVDGKPVIGLPGNIVSSMVVLNMVILEILK 318
229583737 239 KRAISVADVLILTGGTSAGEKDFVHRAIRELGNIIVHGIKIKPGKPTILGIVDGKPVIGLPGNIVSSMVVLNMVILEILK 318
229577984 239 KRAISVADVLILTGGTSAGEKDFVHRAVRELGNIIVHGIKIKPGKPTILGIVDGKPVIGLPGNIVSSMVVLNMVILEILK 318
227826573 239 KRAISVADVLILTGGTSAGEKDFVHRAIRELGNIIVHGIKIKPGKPTILGIVDGKPVIGLPGNIVSSMVVLNMVILEILK 318
227829215 239 KRAISVADVLILTGGTSAGEKDFVHRAVRELGNIIVHGIKIKPGKPTILGIVDGKPVIGLPGNIVSSMVVLNMVILEILK 318
70606758  240 LEGIEKADIVIVTGGSSAGEKDYVHQVIKEEGKIIVHGLKIKPGKPAILAEIKGKPVFGLPGNITSTMVINEEVVDKYID 319
146303454 239 RTAVDKADLIITTGGTSAGEKDYVHQLVREMGNIVIQGLNTKPGKPTILGEIQGKPVFGLSGNIVATIMTFNQLVERYIA 318
15899122  243 KRAISLADVLILTGGTSAGEKDFVHRAIKELGSIIVHGIKIKPGKPTILGVVDNKPVIGLPGNIVSSVVVFDTVISEILR 322
15920721  240 LKGLDLADVVILTGGTSAGEKDFVHQVIRELGKIIVHGLKFKPGKPTILATVKGKPVIGLPGNIVSTVMITERVINKYLS 319
238618659 239 KRAISVADVLILTGGTSAGEKDFVHRAIRELGNIIVHGIKIKPGKPTILGIVDGKPVIGLPGNIVSSMVVLNMVILEILK 318
284996570 239 KRAISVADVLILTGGTSAGEKDFVHRAVRELGNIIVHGIKIKPGKPTILGIVDGKPVIGLPGNIVSSMVVLNMVILEILK 318
229583195 319 SLYP--SRKEILGLGKIKARLVLRVKADEHRNTLIPVYLFRSiDNSYYALPVKFDSYMVGTFSLTEGYIMLGPNEEIEEG 396
229583737 319 SLYP--SRKEILGLGKIKARLALRVKADEHRNTLIPVYLFRSiDNSYYALPVKFDSYMVGTFSLTEGYIMLGPNEEIEEG 396
229577984 319 SLYP--SRKEILGLGKIKARLALRVKADEHRNTLIPVYLFRSiDNSYYALPVKFDSYMVGTFSLTEGYIMLGPNEEIEEG 396
227826573 319 SLYP--SRKEILGLGKIKARLALRVKADEHRNTLIPVYLFRSiDNSYYALPVKFDSYMVGTFSLTEGYIMLGPNEEIEEG 396
227829215 319 SLYP--SRKEILGLGKIKARLALRVKADEHRNTLIPVYLFRSiDNSYYALPVKFDSYMVGTFSLTEGYIMLGPNEEIEEG 396
70606758  320 IMYNisSYRY-----TIKATITNEVKADYNRTTYIPVYLIKK-DGKYYAIGMPFDSYMIGVFSTADGYIIINPGENIEEG 393
146303454 319 EFSGrsLATRTAYHDKVSAISILPIKADRYRVTNIPVYIVKG-RGGHYAIPVPFDSYMVGTFASSDGYVTLPPGTQVKEG 397
15899122  323 NLYP--SRKEIVELGKIKAKLALGTKADKYRNTLIPVYLFKSvDSSYYALPVKFESYMIGTFSLTEGYIMLNPNEEIEEG 400
15920721  320 IV----AGKELTDEIKVKAILLNDAKADKNRYTYLPVYLFKK-DEKYFALSIPFDSYMIGTFSVADGYIGLEPAEEHKEG 394
238618659 319 SLYP--SRKEILGLGKIKARLALRVKADEHRNTLIPVYLFRSiDNSYYALPVKFDSYMVGTFSLTEGYIMLGPNEEIEEG 396
284996570 319 SLYP--SRKEILGLGKIKARLALRVKADEHRNTLIPVYLFRSiDNSYYALPVKFDSYMVGTFSLTEGYIMLGPNEEIEEG 396
229583195 397 KEVEVDVKKFDDSISIIGEEDKRILNL--DTKNVLLGSLPASKAIEYKFGDVAVISSLFTEPIENYDKVLCRQILVNGEG 474
229583737 397 KEVEVDVKKFDDSISIIGEEDKRILNL--DTKNVLLGSLPASKAIEYKFGDVAVISSLFTEPIENYDKVLCRQILVNGEG 474
229577984 397 KEVEVDVKKFDDSISIIGEEDKRILNL--DTKNVLLGSLPASKAIEYKFGDVAVISSLFTEPIENYDKVLCRQILVNGEG 474
227826573 397 KEVEVDVKKFDDSISIIGEEDKRILNL--DTKNVLLGSLPASKAIEYKFGDVAVISSLFTEPIENYDKVLCRQILVNGEG 474
227829215 397 KEVEVDVKKFDDSISIIGEEDKRILNL--DTKNVLLGSLPASKAIEYKFGDVAVISSLFTEPIENYDKVLCRQILVNGEG 474
70606758  394 SEVSVYLRSLDERPVYIGEEEPTLYPR--GFRVLPFGSYIGLKAIKYGIGDVIVISNLYDSNFKG-DLSKERNVIETGEG 470
146303454 398 ERIEVTLKSLDNRPVIIGEEDVRIREV--KARKILLGTVPACAALKYDVGDALILSDFLCEDKVPEAVEVKRWILSHGSG 475
15899122  401 KEVEVNVKKFDDSISIIGEEDKRILNS--DTKNVLLGSLPAKKAIEYKFGDVAVISSLYSSSVDNYDRVFCRQILVNGEG 478
15920721  395 EEVYVYLKRLDLRPTYIGEEEPKLLKLfsEFRKIPLGSYPALKALKYGIGDVIVISSLYDNSISG-EYVYKRKILQNGNG 473
238618659 397 KEVEVDVKKFDDSISIIGEEDKRILNL--DTKNVLLGSLPASKAIEYKFGDVAVISSLFTEPIENYDKVLCRQILVNGEG 474
284996570 397 KEVEVDVKKFDDSISIIGEEDKRILNL--DTKNVLLGSLPASKAIEYKFGDVAVISSLFTEPIENYDKVLCRQILVNGEG 474
229583195 475 EE-IGYDDWIGMSKIVKNPVVKLKSPSTIYSLVGKARVYAPEGYIV-GDKVTEECLYMIGISERGKRYLSAIKV 546
229583737 475 EE-IGYDDWIGMSKIVKNPVVKLKSPSTIYSLVGKARVYAPEGYIV-GDKVAEECLYMIGISERGKRYLSTIKV 546
229577984 475 EE-IGYDDWIGMSKIVKNPVVKLKSPSTIYSLVGKARVYAPEGYIV-GDKVAEECLYMIGISERGKRYLSAIKV 546
227826573 475 EE-IGYDDWIGMSKIVKNPVVKLKSPSTIYSLVGKARVYAPEGYIV-GDKVAEECLYMIGISERGKRYLSTIKV 546
227829215 475 EE-IGYDDWIGMSKIVKNPVVKLKSPSTIYSLVGKARVYAPEGYIV-GDKVAEECLYMIGISERGKRYLSAIKV 546
70606758  471 SEyVGYLEWVGLSKLVKDPVVKLRYPSVALQLMDKAKIIIPDTFHKdGKVIGKEKLEIIVRNPDIKKYFRG--- 541
146303454 476 DP-IGYHDWIGMSRLVKDPAVKLKSPSTAPLFLGKGKVIAPHGYIE-GEKVTQEKLKVV-VRNRDLQFLEGIFS 546
15899122  479 EE-IGYDDWIGMSKIVKNPVVKLRSPSTIYSLLGKAKVYAPEGYII-GKKVFEECLYMIGISERGKRYLSTIKV 550
15920721  474 EKiVGYHDWIGLSRMIQNSSIKLRYISLSPNFIGKATVIAPDTIISeGKEIGEEKLIIVCKDE----YKSKLKT 543
238618659 475 EE-IGYDDWIGMSKIVKNPVVKLKSPSTIYSLVGKARVYAPEGYIV-GDKVAEECLYMIGISERGKRYLSTIKV 546
284996570 475 EE-IGYDDWIGMSKIVKNPVVKLKSPSTIYSLVGKARVYAPEGYIV-GDKVAEECLYMIGISERGKRYLSAIKV 546
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap