Conserved Protein Domain Family
PRK14495

?
PRK14495: PRK14495 
putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/unknown domain fusion protein; Provisional
Statistics
?
PSSM-Id: 172967
View PSSM: PRK14495
Aligned: 4 rows
Threshold Bit Score: 841.26
Threshold Setting Gi: 221640194
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
126463151   1 MRVYGIIGWKDAGKTALVERLVAAIAARGFSVSTVKHSHHDVDPDPPGSDSHRHRAAGAAEVVLAGPRRLILTREHRGEP 80 
146278489   1 MRIYGIIGWKGAGKTCLVERLVAAIGARGFSVSTVKHSHHDVDPDRPGSDSHRHRVAGASEVVLAGPGRFVLTHEHRGEA 80 
77464310    1 MRVYGIIGWKDAGKTGLVERLVAAIAARGFSVSTVKHSHHDVDPDPPGSDSHRHRAAGAAEVVLAGPRRLILTREHRGEP 80 
221640194   1 MRVYGIIGWKDAGKTGLVERLVAAIAARGFSVSTVKHSHHDMDPDPPGSDSHRHRAAGAAEVVLAGPRRVILTREHRGEP 80 
126463151  81 PRLAAILERMAPVDLVLVEGYKTEPHPKIEVFRKAAGHALRQPEDPWVRAVASDTQMALPVPVLDLDDTEAVADFLLTDS 160
146278489  81 PRLAAILDRMAPVDLVLVEGFKSEPHPRIEVFREGAGHAPIQTEDPWVRAVASDAALALPVPVLDLDDTEAVADFILKDS 160
77464310   81 PRLAAILERMAPVDLVLVEGYKTEPHPKIEVFRKAAGHALRQPEDPWVRAVASDTQMALPVPVLDLDDTEAVADFLLTDS 160
221640194  81 PRLAAILERIAPVDLVLVEGYKTEPHPKIEVFRKAAGHALRQPEDPWVRAVASDTQMALPVPVLDLDDTEAVADFLLTDS 160
126463151 161 GLVRSGFDTVIAVDWSGASVPSPRKPSSDAIWIGVASPLGETVSYHRTRADAEAHLNDLFAFELTAGRRVLAGFDFPFGY 240
146278489 161 GLVRSGFDTVIAVDWSGASVPSPRKPSSDAIWIGVASPLGETVSYHRTRADAEAHLNDLFAFELVAGRRVLAGFDFPFGY 240
77464310  161 GLVRSGFDTVIAVDWSGASVPSPRKPSSDAIWIGVASPLGETVSYHRTRADAEAHLNDLFAFELTAGRRVLAGFDFPFGY 240
221640194 161 GLVRSGFDTVIAVDWSGASVPSPRKPSSDAIWIGVASPLGETVSYHRTRADAEAHLNDLFAFELTAGRRLLAGFDFPFGY 240
126463151 241 PEGFAPRLTGQAFAPALWDWLEARIEDGPDNANTRFQFADRINAGFPGQGPFWGRPGGLALDHLPDRKLCDHEALGIAER 320
146278489 241 PEGFAPRLTGEAFAPALWEWLEARIEDGPDNANNRFQLADRINADLPGEGPFWGRPGGLDLAHLPDRKLCDHAALGLAER 320
77464310  241 PEGFAPRLTGQAFAPALWDWLEARIEDGPDNANTRFQFADRINAGFPGQGPFWGRPGGLALDHLPDRKLCDHEALGIAER 320
221640194 241 PEGFAPRLTGQAFAPALWDWLEARIEDGPDNANTRFQFADRINAGFPGQGPFWGRPGGLALDHLPDRKLCDHEALGIAER 320
126463151 321 RRVEQAVPKAHPVWKLYTTGSVGSQALLGLPVIARLRRRFHAQAWPFEPATGPIVLAEIYPSLLGPAISKATREGEIKDS 400
146278489 321 RRVELAVPKAHPVWKLYTTGSVGSQALLGLPVIARLRRRFHAQAWPFEPASGPLVVAEIYPSLLGPAIAKATRDGEIKDS 400
77464310  321 RRVEQAVPKAHPVWKLYTTGSVGSQALLGLPVIARLRRRFHAQAWPFEPATGPIVLAEIYPSLLGPAISKATREGEIKDS 400
221640194 321 RRVEQAVPKAHPVWKLYTTGSVGSQALLGLPVIARLRRRFHAQAWPFEPATGPIVLAEIYPSLLGPAISKATREGEIKDS 400
126463151 401 AQVRLMARALWRMARDGSLAALLADVPDWPGRAEEGWILGAGQAEQLRLALI 452
146278489 401 AQVRLMARALWRMARDGSLSELLEDVPDWPGRREEGWILGAGHAEQLRLALI 452
77464310  401 AQVRLMARALWRMARDGSLAALLADVPDWPGRAEEGWILGAGQAEQLRLALI 452
221640194 401 AQVRLMARALWRMARDGSLTALLADVPDWPGRAEEGWILGAGQAEQLRLALI 452
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap