Conserved Protein Domain Family
PRK14483

?
PRK14483: PRK14483 
DhaKLM operon coactivator DhaQ; Provisional
Links
?
Statistics
?
PSSM-Id: 172956
View PSSM: PRK14483
Aligned: 43 rows
Threshold Bit Score: 485.322
Threshold Setting Gi: 76787654
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
163938871   1 MKKIMNDVENIVQDMLHGFYFEHNdkvNYDETHNIIYVKDIVEMEQNVVIISGGGSGHEPADIGYVGKGMLTAAVNGSIF 80 
116511074   1 -MKFYTSTTEIPEEMLKGVELTHT---HLSYLSETGILYDNTFDNKAVPIISGGGSGHEPAHIGYVGDGMLAAAVAGPLF 76 
76787654    1 ---------------------------------------------------------------------MLSAAISGPIF 11 
125623131   1 -MKFYTSTTEIPEEMLKGVELTHT---HLSYLSETGILYDNTLDNKAVPIISGGGSGHEPAHIGYVGAGMLAAAVTGPLF 76 
25011732    1 MRKTEHHKMEYVFETIKAITKTNP---KVEQIKDLPAIHYLGQSEQVIPILSGGGSGHEPAHFGYVGEGMLSAAISGPIF 77 
22537787    1 MRKTEHHKMEYVFETIKAITKTNP---KVEQIKDLPAIHYLGQSEQVIPILSGGGSGHEPAHFGYVGEGMLSAAISGPIF 77 
30023982    1 -MKFYNSTNEIPEEMLKGIDLTYP---QLTYLPETGILYDNTYNEKTVPIISGGGSGHEPAHVGYVGSGMLAAAVTGPLF 76 
253756366   1 MVFIRNRQATIIEDYLDGFCRTNP---KVKKVKGLPIVLQKVQDDHLVPIISGGGSGHEPAHIGFVGKGMLTAAVYGEIF 77 
253754433   1 MVFIRNRQATIIEDYLDGFCRTNP---KVKKVKGLPIVLQKVQDDHLVPIISGGGSGHEPAHIGFVGKGMLTAAVYGEIF 77 
253752607   1 MVFIRNRQATIIEDYLDGFCRTNP---KVKKVKGLPIVLQKVQDDHLVPIISGGGSGHEPAHIGFVGKGMLTAAVYGEIF 77 
163938871  81 TPPTVEQIIAATRLMPKNKSILFIIKNFKDDVANFLEAEQIAKEEGRRIDHIIVNDDVSIEDDASFNKRRRGVAGTVFVQ 160
116511074  77 VPPRAKNILKAIRQVNSGKGVFVIIKNFEADLKEFKKAIEEARTEGIDVRYIVSHDDISVNA-YNFHKRHRGVAGTVLLH 155
76787654   12 VPPCASDILETIRFINRGKGVFVIIKNFEADLEEFSQAIEQARQEGIPIKYIVSHDDISVET-SNFKIRHRGVAGTVLLH 90 
125623131  77 VPPRAKNILKAIRQVNSGKGVFVIIKNFEADLKEFKKAIEEARTEGIDVRYIVSHDDISVNT-YNFHKRHRGVAGTILLH 155
25011732   78 VPPCASDILETIRFINRGKGVFVIIKNFEADLEEFSQAIEQARQEGIPIKYIVSHDDISVET-SNFKIRNRGVAGTVLLH 156
22537787   78 VPPCASDILETIRFINRGKGVFVIIKNFEADLEEFSQAIEQARQEGIPIKYIVSHDDISVET-SNFKIRHRGVAGTVLLH 156
30023982   77 IPPKSKNILKAIRQVNSGKGVFVIIKNFEADLKEFNEAIKEARTEGIDVRYIVSHDDISVNA-YNFHKRHRGVAGTILLH 155
253756366  78 TPPTAEEVFAAIRAVDKGKGVFLIVKNFEADLISFRKAIELARQEGIAVKYIVSHDDISVDTKNNFRMRHRGLAGTILLH 157
253754433  78 TPPTAEEVFAAIRAVDKGKGVFLIVKNFEADLISFRKAIELARQEGIAVKYIVSHDDISVDTKNNFRMRHRGLAGTILLH 157
253752607  78 TPPTAEEVFAAIRAVDKGKGVFLIVKNFEADLISFRKAIELARQEGIAVKYIVSHDDISVDTKNNFRMRHRGLAGTILLH 157
163938871 161 KIVGAAAESGHSLEELTALGQSVIKNLHTLGVALSPANDPVQGKASFTLNDDEVFYGVGIHGEKGYRKEALSSSEILAIE 240
116511074 156 KILGAFAKEGASIDEIEQLALSLSPEIYTLGVALAPVHFPHQ-KTSFVLAEDEVSFGIGIHGEPGYRVEKFEGSERIAVE 234
76787654   91 KIIGQAALEGASLDELEQLGLSLTTSMATLGVASKSATILGQHQPVFDLEEGYISFGIGIHGEPGYRTMPFVSMEHLANE 170
125623131 156 KVLGAFAKEGASIDEIEQLALSLSPEIYTLGVALAPVNFPHH-RTSFLLAEDEVSFGVGIHGEPGYRIEKFEGSERIAVE 234
25011732  157 KIIGQAALEGASLDELEQLGLSLTTSMATLGVASKSATILGQHQPVFDLEEGYISFGIGIHGEPGYRTMPFVSMEHLANE 236
22537787  157 KIIGQAALEGASLDELEQLGLSLTTSMATLGVASKSATILGQHQPVFDIEEGYISFGIGIHGEPGYRTMPFVSMEHLANE 236
30023982  156 KILGAFAKEGGSIDEIEQLALSLSPEIYTLGVALAPVHFPHQ-KTSFVLAEDEVSFGIGIHGEPGYRVEKFEGSERIAIE 234
253756366 158 KILGAAALTGYSLDELEQLGLSLATEIATIGFATKSAYLPNAALPLFDLEEGQISYGIGIHGEEGYRTVRFESSEQLANE 237
253754433 158 KILGAAALTGYSLDELEQLGLSLATEIATIGFATKSAYLPNAALPLFDLEEGQISYGIGIHGEEGYRTVRFESSEQLANE 237
253752607 158 KILGAAALTGYSLDELEQLGLSLATEIATIGFATKSAYLPNAALPLFDLEEGQISYGIGIHGEEGYRTVRFESSEQLANE 237
163938871 241 LMNKLKSIYRWRK--GDNFAILINGLGATPLMEQYIFANDIRRLCELEGLHVKFVKVGTLLTSLDMKGVSLSLLKIEDSD 318
116511074 235 LVNKLKAEINWQKkaNKNYILLVNGLGSTTLMELYHFQYDVMRLLELEGLSIKFCKVGNLMTSCDMSGISLTLCSVKDFK 314
76787654  171 LVNKLKMKLRWQD--GEAFILLINNLGGSSKMEELLFTNAVMEFLALDDLQLPFIKTGHLITSLDMAGLSVTLCRVKDSR 248
125623131 235 LVNKLKAEINWQKkaNKNYILLVNGLGSTTLMELYHFQYDVMRLLELEGLSIKFCKVGNLMTSCDMSGISLTLCSVKDPK 314
25011732  237 LVNKLKMKLRWQD--GEAFILLINNLGGSSKMEELLFTNAVMEFLALDDLQLPFIKTGHLITSLDMAGLSVTLCRVKDSR 314
22537787  237 LVNKLKMKLRWQD--GEAFILLINNLGGSSKMEELLFTNAVMEFLALDDLQLPFIKTGHLITSLDMAGLSVTLCRVKDSR 314
30023982  235 LVNKLKAEINWQKkaNKNYILLVNGLGSTTLMELYSFQYDVMRLLELEGLSVKFCKVGNLMTSCDMSGISLTLCSVKDPK 314
253756366 238 IVNKLKLKFRWKE--GEDYILLVNNLGSMSEVEQGIFLNDICQFLELEGLQLSYVKTGKFMTSLDMGGISVTLCRVKDRK 315
253754433 238 IVNKLKLKFRWKE--GEDYILLVNNLGSMSEVEQGIFLNDICQFLELEGLQLSYVKTGKFMTSLDMGGISVTLCRVKDRK 315
253752607 238 IVNKLKLKFRWKE--GEDYILLVNNLGSMSEVEQGIFLNDICQFLELEGLQLSYVKTGKFMTSLDMGGISVTLCRVKDRK 315
163938871 319 WVKWLKADVRASGW 332
116511074 315 WLDYLNAPTGAFAW 328
76787654  249 WIDYLKHKTDARAW 262
125623131 315 WLDYLNAPTGAFAW 328
25011732  315 WIDYLKHKTDARAW 328
22537787  315 WIDYLKHKTDARAW 328
30023982  315 WLDYLNVPTGAFAW 328
253756366 316 WLDFLEAPTEAAAW 329
253754433 316 WLDFLEAPTEAAAW 329
253752607 316 WLDFLEAPTEAAAW 329
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap