Conserved Protein Domain Family
PRK14477

?
PRK14477: PRK14477 
bifunctional nitrogenase molybdenum-cofactor biosynthesis protein NifE/NifN; Provisional
Links
?
Statistics
?
PSSM-Id: 172952
View PSSM: PRK14477
Aligned: 14 rows
Threshold Bit Score: 1455.33
Threshold Setting Gi: 126462950
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
222055671   1 MAKPDYYDVTDCKT-----NDAGAPKFCKKSEPGEGTERSCAYDGARVVLMPITDVIHLVHGPIACAGNSWDNRGARSSG 75  
189423708   1 MAKPDYYDVEDCST-----HEKGAPKFCKKSEPGEGTERSCAYDGARVVLMPVTDAIHLVHGPIACAGNSWDNRGARSSG 75  
197123605   1 MARPSDLDPTDCET-----LEKGAPRFCKRSEPGEGTERSCAYDGARVVLMPVTDAIHLVHGPIACAGNSWDNRGARSSG 75  
209966926   5 DKLADVFNEPACDRnr-akDAAVRRKGCGKPLTPGAAAGGCAFDGAKIVLQPITDAAHLVHGPLACEGNGWDNRGSLSSG 83  
113477559   7 GKVAELLNEPGCEHnhqknNGDKKQKGCQQQAAPGAAQGGCAFDGASIALVPITDAAHLVHGPLGCSGNSWGARGSLSSS 86  
75910449    6 GKINELLSEPGCEHnh-hkHGQKKNKSCHQQAQPGAAQGGCAFDGASIALVPITDAAHLVHGPIACSGNSWGGRGSLSSG 84  
78221889    1 MAKPDYYDVSECET-----HEKGAPKFCKKSEPGEGAERSCAYDGARVVLMPITDVIHLVHGPIACAGNSWDNRGARSSD 75  
118581891   1 MAKPDYYDVTDCDT-----HDKGAPKFCKKSEPGEGTERSCAYDGARVVLMPITDVIHLVHGPIACAGNSWDNRGARSSG 75  
153005883   1 MPRPDYYDAPECET-----QEKGAPKFCRRSEPGEGTERSCAYDGARVVLMPVTDAIHLVHGPIACAGNSWDNRGARSSG 75  
39997899    1 MARPDYYDTTDCET-----HEKGAPKFCKKSEPGEGTERSCAYDGARVVLMPVTDVIHLVHGPIACAGNSWDNRGARSSG 75  
222055671  76 SQLYRRGFTTEMLENDVVFG-GEKKLYKAILEVAGRYp-EAKAIFVYATCVTAMTGDDVEAVCKAAAEKVVVPVIPVNTP 153 
189423708  76 SQLYRRGFTTEMLENDVIFG-GEKKLYKAIIDLAERYp-EAKGMFVYATCVTAMTGDDIESVCKAAQEKVSIPLVPVNTP 153 
197123605  76 SQLYRRGFTTELVQNDVVFG-GEQKLHQAIVDLAARHrgEAKAVFVYSTCVSALTGDDVVAVCRRAAAEVDLPVIPVNAP 154 
209966926  84 PTLYRTGFTTDLSELDIIMGsGEKRLFKAIREIAEAH--RPAAVFVYQTCVPALTGDDVEAVCKAAADRFGLPVIPVNVP 161 
113477559  87 SHLYKMGFTTDMGENDIIMG-GEKKLLRAIAELKKRY--QPPAIFVYATCVTALIGDDLETVCKVATKKLEIPVIPVNSP 163 
75910449   85 SHLYKMGFTTDLSENDIIFG-GEKKLYKAILEVQQRY--QPAAVFVYSTCVTALIGDDLDPVCEAAAKKTGIPVIPVNSP 161 
78221889   76 SQLYRRGFTTEMLENDVVFG-GEKKLYRAILELAERYegQAKAMFVYATCVTAMTGDDVEAVCAAAGKKVAIPLIPVNTP 154 
118581891  76 SQLYRRGFTTEMLENDVVFG-GEKKLYKAILDLAERYrdQAKAIFVYATCVTAMTGDDVEAVCKAAQPKAGMPVIPINAP 154 
153005883  76 SQLYRRGFTTELLENDVVFG-GEKKLRRAILDLAARYp-EARAVFVYATCVSAMTGDDVEAVCRSVAGEVAIPVVPVNTP 153 
39997899   76 SQLYRRGFTTEMLENDVIFG-GEKKLYRAILELAERYagQAKAMFVYATCVTAMTGDDVEAVCKAAQKKVAIPLIPVNTP 154 
222055671 154 GFIGDKNIGNRLAGEILFKYVIGTAEPPVLGEYSINLIGEYNIAGDLWGMLPLFDRLGIRILSCFSGDAKFEELRYAHRA 233 
189423708 154 GFIGDKNIGNRLAGEILFKQVIGTAEPPTLGEYPINLIGEYNIAGDLWGMLPLFDRLGIQILSCFSGDAKFEELRYAHRA 233 
197123605 155 GFVGDKNIGNRLAGEVLLDHVIGTAEPAVRTRYDVNLIGEYNIAGDLWGMLPLFERLGIRVLSCISGDARFDDLRHAHRA 234 
209966926 162 GFVGSKNLGNKLAGETLLDHVIGTMEPEVTTPTDINIIGDFNLAGELWQVEPLFRRLGIRILARMTGDARYAEIAGAHRA 241 
113477559 164 GFIGSKNLGNRVGAEALLDHVVGTAEPEFTTPYDINLIGEYNIAGEMWAMLPLFEKVGIRVLSKITGDATYKEVCYAHRA 243 
75910449  162 GFIGSKNLGNRVGGEALLEYVIGSAEPEYTTPLDINLIGEYNIAGELWGVLPLFEKLGIRVLAKITGNAKYKEVQYAHRA 241 
78221889  155 GFIGDKNIGNRLAGEVLFKHVIGTAEPPVLGEYPINLIGEYNIAGDLWGMLPLFERLGIQVLSCFSGDATFEELRYAHRA 234 
118581891 155 GFIGDKNIGNRLAGEIMFKHVIGTAEPPELGEYPINLIGEYNIAGDLWGMLPLFQRLGIQILSCFSGDAKFEELRYAHRA 234 
153005883 154 GFIGDKNIGNRLAGEVLLEHVIGTAEPATTTPSDVNLIGEYNIAGDLWGMLPLFERLGIRVLSCISGDARFDELRWAHRA 233 
39997899  155 GFIGDKNIGNRLAGEVLLKHVIGTAEPPVLGEYPINLIGEYNIAGDLWGMLPLFDRLGIQILSCFSGDAKFEDLRYAHRA 234 
222055671 234 RLNVIICSKSLTNLAKKMQKTFGMPYIEESFYGMTDTAKALRDIARELDDAVGGLEKRVMQDRVEKLIEEEEAKCRTAIA 313 
189423708 234 KLNIIICSKSLTNLAKKMQKTYGMPYLEESFYGMTDIAKALRNIAIALDDAVNGLEKRIMQDRVEQLLEEEEAKCRERLA 313 
197123605 235 RLNVIVCSKSLTNLARKMRKRWGIPFLEASFYGMTDTARALREMARELDLADGDPADTTLRDRVERLVAEEEAACRARIA 314 
209966926 242 RLNLMICSMALINVARKMEERWGIPYAEVSFYGIEDTSAALRTCARLLVERGAPPD---LIGRTEALIAEEEAKARAAIA 318 
113477559 244 KLNVMICSKAMINMARKMEEEYGIPYIEESFYGVADINNCLRNIAAKIGDAG-------LQERTEKLIAEETTILEEILE 316 
75910449  242 KLNVMICSKALINVARKMEERYGIPYIEESFYGVDDMNRCLRNIAAKLGDQG-------LQERVEQLIAQETAALDIALA 314 
78221889  235 KLNIIICSKSLTNLARKMQKNYGMPYLEESFYGMTDTAKALRDIARELDDAVGGLEKRIMQDRVEKLLEEEEATCRERLA 314 
118581891 235 KLNVIICSKSLTNLAKKMQKTYGMPYLEESFYGMTDTAKALRDIARELDNTVNGLEKRVMQDRVEKLLAEEEEKCRKRIA 314 
153005883 234 RLNVIICSKSLTNLARKMKKRWGIPYLEESFYGMTDTAKALRHIAREL-DLARGDGASVMAEAVEALVAEEEERCRARLA 312 
39997899  235 KLNVIICSKSLTNLARKMQKNYGMPYLEESFYGMTDTAKALRDIARELDDAVGGLEKRIMQDRVEKLLEEEEAQCRERLA 314 
222055671 314 PYRARLEGKRAVLFTGGVKTWSMVNALRELGVEILAAGTQNSTLEDFYRMKGLMHQDAKIIEDTSTAGLLKVMQEKMPDL 393 
189423708 314 PYRARLEGKRAVLFTGGVKTWSMVNALRELGVEILAAGTQNSTLEDFYRMKALMHKDARIIEDTSTAGLLGVMKEKMPDL 393 
197123605 315 PHRARLEGKRAVLFTGGVKTWSMVNALRELGVEVLAAGTQNSTLEDFHRMKSLMHRDAHIIEDTSTAGLLGVMQAKRPDL 394 
209966926 319 VFRPAVEGRRVLLYTGGVKSWSVVSALQELGMVVTGTSVRKSTEEDKARIQEIMGEDAHTFEAIPPKEMYRMLRESEADI 398 
113477559 317 PYRQRLKGKKVVLYTGGVKSWSIISAAKDLEMDVVATSTKKSTEEDKAKIKKLLGKDGILLEKGNAEILLKVIAETKADM 396 
75910449  315 IYRDRLKGKRVVLYTGGVKSWSIISAAKDLGMEVVATSSKKSTEEDKARIRDLLGKDGIVMEKGNAQELLRVIAQTKADM 394 
78221889  315 PYRARLEGKRSVLFTGGVKTWSMVNALRELGVEILAAGTQNSTLEDFYRMKALMHQDARIIEDTSSAGLLQVMYDKMPDL 394 
118581891 315 PYRARLEGKRAVLFTGGVKTWSMVNALRELGVEILAAGTQNSTLEDFYRMKALMHADAGIIEDTSTAGLLAVMREKMPDL 394 
153005883 313 PYRARLEGKRAVLFTGGVKTWSMVNALRELGVEVLAAGTQNSTLEDFHRMKALMHRDARIIEDTSTAGLLEIMREKLPDL 392 
39997899  315 PYRARLEGKRSVLFTGGVKTWSMVNALRELGVEILAAGTQNSTLEDFYRMKALMHQDAGIIEDTSSAGLLKVMYDKMPDL 394 
222055671 394 IVAGGKTKFLALKTRTPFLDINHGRSHPYAGYEGMVTFARQLDLTVNNPIWPALNAAFPWEKSAMELaadVAGAAGHGER 473 
189423708 394 IVAGGKTKFLALKTKTPFLDINHGRSHPYAGYEGMVTFAKQLDLTVNNPIWTLLNSPEPWETDATPL---VNAARSHAAT 470 
197123605 395 VVAGGKTKFLALKTRTPFLDINHGRAHPYAGYAGMVTFARQLDLTVNDPIWKAIDAPVAW-TSEAGTaaaARSARGHAAR 473 
209966926 399 MLSGGRSQFVALKSRTPWLDINQERHRPYAGYAGLVELVRDLATELGNPVWAEVRAPAPWEPGSGAEpaeAPGT------ 472 
113477559 397 LIAGGRNQYTALKARIPFLHINQERHHPYAGYHGMIEMAKELDEALYSPVWEQVRQPAPW------------LEACQLDD 464 
75910449  395 LIAGGRNQYTALKARIPFLDINQERHHPYAGYVGMVEMARELDEALYSPVWGQVRKSALWQEGVGEQrsrGAEEQRGKTV 474 
78221889  395 IVAGGKTKFLALKTKTPFLDINHGRSHPYAGYEGMVTFAKQLDLTVNNPIWPVLNAKAPWEKTEEELtaaVALAAGHARA 474 
118581891 395 IVAGGKTKFLALKTKTPFLDINHGRSHPYAGYEGMVTFAKQLDLTVNNPIWPLLNAPAPWEKSPDQLaedLVEVAGHGER 474 
153005883 393 VVAGGKTKFLALKTRTPFLDINHGRAHPYAGYEGMVTFARQLDLTVSNPIWSALTAPAPWERSAAGLeaeRAAARGHGAA 472 
39997899  395 IVAGGKTKFLALKTKTPFLDINHGRSHPYAGYEGMVTFAKQLDLTVNNPIWPVLNAKSPWEKSDEELaasVARAAGHARA 474 
222055671 474 FLALPIPAAESLCPPpllgrgqgegavspagnsdgnvtlsptlshqggvriKQSTVNPQKNSPALGATLAFLGIDGMLGL 553 
189423708 471 YLAEDLAASRVAVPK------------------------------------KAATVNPQKNSPALGATLAYLGIDQMLGL 514 
197123605 474 LEAEDLSASRVKVPA------------------------------------KAATVNPQKNSPALGATLAYLGVDRMLGL 517 
209966926 473 --------TPVRLPT------------------------------------AAHSRNPLKSSQPLGAALAFMGLDRTMPL 508 
113477559 465 VLAVETLPSLTNIPPttvn-----------------------------fhkQSLSTNPLKLSQPLGAALAYLGINGMMPM 515 
75910449  475 VQNSH----------------------------------------------KSVAVNPLKQSQPLGAALAFLGLKGVMPL 508 
78221889  475 CLDEDLKDSTVKVPA------------------------------------KNATVNPQKNSPALGATLAYLGIDQMLAL 518 
118581891 475 FLAEDLSASRVRVST------------------------------------KSAVVNPQKNSPALGATLAYLGIDNMLGL 518 
153005883 473 LLAEELSASRVKVPA------------------------------------KPATVNPQKNSPALGATLAYLGVDRMLAL 516 
39997899  475 YLDEDLKDSRVKVPT------------------------------------KPATVNPQKNSPALGATLAYLGIDQMLAL 518 
222055671 554 LHGAQGCSTFIRLQLSRHFKESIALNSTAMSEDTAIFGGWENLKKGIGRVIEKFDPRVVGVMTSGLTETMGDDVRSAIVH 633 
189423708 515 LHGAQGCSTFIRLQLSRHFKESIALNATAMSEDSAIFGGWENLKKGIGRVIEKFGPKVVGVMTSGLTETMGDDVRSAIHQ 594 
197123605 518 LHGAQGCSTFIRLQLSRHFKESIALNSTAMSEDSAIFGGWENLKQGLARVAEKFHPGVIGVMTSGLTETMGDDVRSAVVQ 597 
209966926 509 LHGSQGCTSFALVLAVRHFRENIPLQTTAMNEVTTILGGADNLEQAIHNLRDRAKPRVIGIATTALMETRGEDIAGDLRL 588 
113477559 516 FHGTQGCTAFAKVLLVNHFQEAIPLSTTAMSEVTTILGGEDNIDKALLTQLEKSKPKVIGLLTTGLTETRGDDMERILKK 595 
75910449  509 FHGSQGCTAFAKVMLVRHFREAIPLSTTAMTEVTTILGGEDNIEQAILTLVEKSKPEIIGLLTTGLTETRGDDMEGILRS 588 
78221889  519 LHGAQGCSTFIRLQLSRHFKEPVALNSTAMSEDTAIFGGWENLKKGLKKVIEKFSPEVVGVMTSGLTETMGDDVRSAIVH 598 
118581891 519 LHGAQGCSTFIRLQLSRHFKESIALNATAMSEESAIFGGWENLKQGIKRVMEKFHPGVVGVMTSGLTETMGDDVQSAIVH 598 
153005883 517 LHGAQGCSTFIRLQLSRHFKESIALNSTAMSEDAAIFGGWSNLKAGLARVIEKFRPGVVGVMTSGLTETMGDDVRSAIAQ 596 
39997899  519 LHGAQGCSTFIRLQLSRHFKEPIALNSTAMSEDTAIFGGWENLKAGLARVMEKFRPTVVGVMTSGLTETMGDDVRSAIHQ 598 
222055671 634 FRRENPQYDHVPVVWASTPDYCGSMQEGYAAAVEAIVD-ALveEEDEATIVTQVNLLPGVHLTPADVEALKEITESFGLT 712 
189423708 595 FRVEHPEHDQVPIIWASTPDYCGSLQEGYANTVEAILA-TL--PEAGEPIPGQVNLVPGAQLTPADVEELKELIESFGLS 671 
197123605 598 FRAEHPELDGLPVVWASTPDYCGSMQEGYAAAVEALLA-AL--AGGGERLPSQVTLLPGAHLTPAEVEELKLLVEAFGLE 674 
209966926 589 IRQRRPEFADTRICLVSTPDYDGAIETGWGRAVHAMVEeMVpaGAPGAVNARQVNILPGSHLTAADIDELRDMVAAFGLV 668 
113477559 596 FREEHPELDGFPILNVSSPDYKGSAQDGFATTVECIVGyDYgePIPKEIKKPLITILAGSCLAPGDVQEIKDIVEDFGFI 675 
75910449  589 IRKRHPELYDLPIIFASTPDFQGALQDGFATAVESIVK-EI--PQPGETRLDQINILVSSAFTPGDIQEIKEIVSAFGLE 665 
78221889  599 FRQEYPEHDGVPVVWASTPDYCGSLQEGYAATVEAIVR-SV--PEPGETIPGQVTVLPGAHLTPADVEEVRELCEAFGLD 675 
118581891 599 FRRENPELADTPVIHASTPDYCGSLQEGYAAAVEAILS-TL--PEGGTAVPGQVNLLPGSHLTPADVEQIRELMEEFGLT 675 
153005883 597 FREEHPEHAGVPIVWASTPDYCGSLQEGYAAAVEALVS-TL--VDGGAPIPGQVTLLPGAHLTPADVEELKGTIEAFGLS 673 
39997899  599 FREEHPEHDNVPVVWASTPDYCGSLQEGYAAAVEAIVR-SV--PEPGASIPDQVTVLPGAHLTPADVEEVREICEAFGLD 675 
222055671 713 PVVIPDISNALDGH-IDDTVSPLSTGGITVEHIRAAGRSAATLYIGDSLAKAALKLKERCGIPAYGFTSVTGLKEVDMLM 791 
189423708 672 VLCVPDIANALDGH-IDADVSPLSTGGISVDKIRQAGRSIATLYVGDSLARAASQLEERLGIPAYGFTSLTGMAETDHFM 750 
197123605 675 CLAVPDLSCALDGH-VDDEVSPLSTGGVPVEALRRAGRSAATIYVGDSLARAARRLEERFGVPAHGFTSATGLLETDALV 753 
209966926 669 PVVVPDIGGSLDGH-IPESWSGSTNGGATVEDVTGLARGRLTLAVGEQMRAAAEALERRAGVPFRLLPSLTGLRATDRLV 747 
113477559 676 PIVVPDLSQSLDGHlIDDIYSATSSGGTTIEDLRNLRHSSFTFAIGESMRNAAIILQEKFGTQYQVFSRLTGLGAVDSFM 755 
75910449  666 TIVVPDHSTSLDGH-LDDSYSAVTGGGTTLAELRQMGSSVFTLALGESMRRAAESLQTQFGIPYEVFPQLTGLDAVDNFL 744 
78221889  676 PIIVPDIANALDGH-IDETVSPLSTGGVSMARIRQAGQSAATLFIGDSLAKAAEAMTERCGMPSYGFTSLTGLAQVDRFM 754 
118581891 676 VLTIPDISCAMDGH-IDEQVSPLSTGGIAVEAIRRAGRSVATIYVGDSLARAALKMKEKFAIPAYGFTSLSGLGETDLFM 754 
153005883 674 VVAVPDVANALDGH-IDAEVSPLSTGGAGVDAIRSAGRSVATLYVGDSLARAARSLEEAHGVPAYGFTSLTGIGEVDRLV 752 
39997899  676 PIIVPDIANALDGH-IDETVSPLSTGGVSPERIRQAGRSAAAIFIGDSLAKAAEALTTTCGMPNYGFTSLTGLAEVDRFM 754 
222055671 792 ETLSAI----------SGRPIPEKHRRWRSRLTDAMVDSHYQFGNKKVALALEADNLKTLTGFLAGMGCEVQAALSAT-R 860 
189423708 751 STLSAI----------SGKAIPEKQQRWRSRLADALVDSHYQFGNKKVAIALEADHLKGMTRFLAGMGCQIQAALAAT-R 819 
197123605 754 ATLSAI----------SGRPVPEALRRARSRLLDAMVDSHYALAGKKVALALEADHLKGLAPFLAGMGCEVQAALAAT-R 822 
209966926 748 RALLEL----------AGGEVPPALKRQRSQLQDALLDGHFYLEGRRVAVAGDPDLLYALSGLFRSLGAEISVAVASTdR 817 
113477559 756 LKLSQLivsridphldKGCEVPEKYLRQRRQLQDAMLDTHFYFGHKQVSIALEPDLLWATSWFVREMGGDIHSAVTTT-R 834 
75910449  745 QGLVDI----------SGNAVPEKYRHQRRQLQDAMLDTHFYFGRKRVSLALEPDLLWSIASFLASMGAEIHAAVTTT-K 813 
78221889  755 ETLAAI----------AGRPIPEKFRRWRSRLMDAMVDSHYQFGLKKVTVALEGDNLKTLVNFLAGMGCEIQAAIAAT-R 823 
118581891 755 ETMSAL----------SGRPIPEKQQRWRSRLMDAMVDSHYQFGAKRVALALESDNLKSLTTFLAGMGCQIQAALSAT-R 823 
153005883 753 ATLAAI----------SGRPVPGALRRARSRLMDAMVDSHYQLGGKRVALALEADPLKVLTRFLHGMGCEVTAALAAT-R 821 
39997899  755 ETLSAI----------SGRPIPEKFNRWRSRLMDAMVDSHYQFGLKKVTVALEGDNLKVLTNFLAGMGCEIRAAIAAT-R 823 
222055671 861 TRGLDALPSATVFVGDLEDLET--AALGADLLVANSNGRQAAAKLGIKAHLRAGLPVFDRLGAHQKMWVGYRGTMNLVFE 938 
189423708 820 TRGLDSLPCNNVFVGDLEDLET--AAVGADLLVANSNGRQAAAKLKIGAHLRTGLPVFDRLGAHQKMWVGYRGTLNLVFE 897 
197123605 823 TRGLDRLPAARVAVGDLEDLED--AARGADLVVASSNGRQAVQKLGIKAHLRTGYPVFDRLGAHQKVWVGYRGTMDLVFE 900 
209966926 818 SPLLARIEAPTVHVGDLGLCETlmREAGADLLVTTAHGRQAAERLGI-PLLRAGFPVFDRLGPAHLRRVGYRGTRDLVFE 896 
113477559 835 SPLLEKLPTENVIVGDLGDLEE--VAAGSDLLITNSRGKIISEKLNIDLY-RMGMPIYDRLGNGQRCSVGYRGTMNLLFD 911 
75910449  814 SPLLEKLPVEKVTIGDLEDFER--LAVGSDLVIANSHGKAISRRLQT-SFYRLGFPIFDRLGNGQRCTVGYRGTTQLLFD 890 
78221889  824 VRGLDGLPARDIFVGDLEDLET--AARGSDLIVANSNGRQAAAKLGIKAHLRAGLPVFDRLGAHQKMWVGYRGTMNLLFE 901 
118581891 824 TRGLDSLPCDNVFVGDLEDLET--AAQGVDLLVANSNGRQAAARLKIGAHLRAGLPVFDRLGAHQKMWVGYRGSMNLLFE 901 
153005883 822 TRGLHELPAATVAAGDLEDLEG--AAEGVDLVVANSNGRQAVARLGVKAHLRAGLPVFDRLGAHQKVWVGYRGTMNLVFE 899 
39997899  824 VRGLDALPAGDVFVGDLEDLET--TAKGCDLIVANSNGRQAAAKLGIKAHLRAGLPVFDRLGAHQKMWVGYRGTMNLLFE 901 
222055671 939 VANIF----------QANAKESQKLAHN 956 
189423708 898 VANLF----------QANAKDAQKLAHN 915 
197123605 901 VANLL----------QAGAGEAQRLAHN 918 
209966926 897 AANLLldarshhhdtKGGGHDGASVGAH 924 
113477559 912 IGNIF----------LEQEESKIHTNDY 929 
75910449  891 IGNLF----------LEAEEEKAKH--- 905 
78221889  902 TANLF----------QANAGEGQKLAHN 919 
118581891 902 VANLF----------QANAKEAQKLAHN 919 
153005883 900 VANLF----------QASATEAQRLAHN 917 
39997899  902 TANLF----------QANAGDAQKLAHN 919 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap