Conserved Protein Domain Family
PRK14473

?
PRK14473: PRK14473 
F0F1 ATP synthase subunit B; Provisional
Statistics
?
PSSM-Id: 172948
View PSSM: PRK14473
Aligned: 6 rows
Threshold Bit Score: 207.468
Threshold Setting Gi: 219847910
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
163848589   1 MEALGINPTLFIAQLINFLLLIFILRALLYRPVMNLLNERTRRIEESVRDAEKVREQLANARRDYEAEIARARQEAAKIV 80 
159900581   1 MDKLGVDLPLLISQIVNFCLLAFLLNTFLYKPVLNALQARSERIRESLDNAEKVKQQLARVDADYEAKLQEARREGQTII 80 
219847910   1 MEALGINLNLFLAQLVNFLLLIFILRALLYRPVMNLLNERTKRIEESVRDAEKVREQLANAKRDYEAELAKARQEAARIV 80 
222526524   1 MEALGINPTLFIAQLINFLLLIFILRALLYRPVMNLLNERTRRIEESVRDAEKVREQLANARRDYEAEIARARQEAAKIV 80 
148654685   1 MEKLGINWGLLIAQLINVIFVVWLLTTFLYRPILNMLNQRTSRIQEGLQDAEKVKEQLANAKRDYDAELAKARQEAAAIL 80 
156741255   1 MEKLGINWGLLIAQLINVVFVVWLLTTFLYRPILNMLNQRTNRIQEGLQDAERVREQLANAKRDYDAELAKARQEAASIL 80 
163848589  81 AQAQERAKQQEAEIIAQARREAERLKEEARAQAEQERIRMLSEAKSQIADLVTLTASRVLGAELQARGHDALIAESLAAL 160
159900581  81 SQAQERARAQEAELLVVARNNAAKIEEEARGKVEQERQQVLRGLQGQLASLVTETASNVLGRELQTKGHDELINKSIDQL 160
219847910  81 AQAQERAKQQEAEIIAQARREAERLKEEARVQAEQERARLLSEAKSQIADLVTLTASRVLGAELQARGHDALIAESLAAL 160
222526524  81 AQAQERAKQQEAEIIAQARREAERLKEEARAQAEQERIRMLSEAKSQIADLVTLTASRVLGAELQARGHDALIAESLAAL 160
148654685  81 AQAQERARAQAAEIIAQAHRDAEKIKSDALAQAEQERLRMLGELKDRMAELVVLTAERVLGEELKTN-HDRLIEESLAEL 159
156741255  81 AQAQERARAQAAEIIAQAHRDAEKIKSDTLAQAEQERQRMLGELKDRMAELVVLTAERVLNAELKAN-HDRLIEESLAEL 159
163848589 161 DRRN 164
159900581 161 GRLN 164
219847910 161 DRRN 164
222526524 161 DRRN 164
148654685 160 GKYN 163
156741255 160 GKYN 163
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap