Conserved Protein Domain Family
PRK14472

?
PRK14472: PRK14472 
F0F1 ATP synthase subunit B; Provisional
Statistics
?
PSSM-Id: 172947
View PSSM: PRK14472
Aligned: 11 rows
Threshold Bit Score: 245.103
Threshold Setting Gi: 193215091
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
119358471   1 MLTSGVILLNGGLLSPNPGLIFWTTVSFVIVLLILRKLAWGPIISALEEREKGIQSSIDRAHKAKDEAEEILRKNRELLA 80 
145220542   1 MLMSAVILLSGSLLDPNPGLIFWTAITFVLVLLILKKIAWGPILGALEEREKGIQSSIDRAYGAKEEAEAILRQNKETLA 80 
78187938    1 MLTSGNILLAGSLLSPEPGLIFWTTITFVLVLIILKKIAWGPIISALEEREKGIQSSIDRAHGAKEESEAILRQNRELLA 80 
78188050    1 MLTSGTILLAGSLLSPNPGLIFWTAITFVIVLLILKKIAWGPIIGALEEREKGIQSSIDRAEKAKDEAEAILRKNRELLS 80 
21672860    1 MLTSGIILLEGGLLNPNPGLIFWTALTFLIVLVILRKTAWGPILSMLEERAKSIQSAIDRAHTAKDEAEAILKKNRDLLA 80 
189501405   1 MLTSGIIVLSGGLLDPNPGLIFWTTVTFLIVLFILKKFTWGPMLSALEEREKGIKNSIDRAQSAKEEAEAVLNKNRQLLA 80 
189347958   1 MLTSGIILLSGGLLSPNPGLIFWTAVTFVIVLLILKQLAWGPIISALEEREKGIQSSIDRAYSAKDEAEAILRKNRDMLA 80 
194335033   1 MLTSGIVILSGGLLDPNPGLIFWTAVTFVIVLLILKKFAWGPILGALEEREKAIQSSIDRAHTAKDEAEAALRKNKELLT 80 
194337849   1 MLTSGIILLAGSLLSPNPGLIFWTAITFVIVLLILKKIAWGPIIGALEEREKGIQSSIDRAHSAKEESEAILRKNRELLA 80 
193213684   1 MLTSGIILLSGGLLSPNPGLIFWTAVTFVIVLVILKKIAWGPIVSMLEEREKGIQSAIDRAHTAKEEAESILKKNKEMLA 80 
193215091   1 MLTTGMFLLEGSLLSPNPGLIFWTAVTFLLLLLLLKKLAWGPILSALEEREKSIQSAIDRANSAKDDAEKLLSKNKDAMN 80 
119358471  81 KADAESDKIIREGKEYGEKLRAGIAEKAQAEAAKMISMAKEEIEQEKRRALDVLRNEVAELAVMGAEKIIKTSLDADMQK 160
145220542  81 KAEAESDRIIREGREFADKIRAEITEKAHTESQKMIGAAKDEIEQEKRRALDVLRNEVADLAVRGAEKIIRASLDGEVQR 160
78187938   81 KADAEADRVIREGREYAEKIRAEITEKAHQESQKMISAAKEEIEQEKRRALAELRNEVADLAVRGAEKIIRGVLDADVQK 160
78188050   81 KADAESEKIVREGKEYAEKLRTDITEKAHTEAAKMIASAKEEIEQEKRRALDVLRNEVADLAVLGAERIIRESLNADMQK 160
21672860   81 KADAEADKIIREAKEVADKLRADLTEKAHDESRKIIASAKEEIEQEKRRALDVLRNEVADMAVKGAEKIIRTTLDADKQK 160
189501405  81 QAGADADKIIREGKEYGDKLKAEITEKAHLEASRMISSAKDEIDQEKRRALTELRTEVADLAVKGAEKIIMANLDAEKQK 160
189347958  81 KADLESERIIREGKEYGEKLRQEMAEKAQFEAKKMIASAKDEIEQEKRRALDVLRNEVADLAIMGAEKIIKSSLDADTQK 160
194335033  81 KADAEAEKILREGKEYGEKLRADIVEKAHSEATKMISSAKEEIEQEKRRALDELRNEVADLAVQGAEKILMANLDADKQK 160
194337849  81 KADAESDKIIREGKDYADKLRADITEKAQSEAKKMIATAKDEIEQEKRRALDVLRNEVADLAVKGAEKIIKTTLDADMQK 160
193213684  81 KADAEADKIIREGKEYADKVRSELTEKAQVESQKMIAAAKEEIEQEKRRALDVLRNEVADMAVKGAEKIIRTTLDADKQK 160
193215091  81 KAEVEADRIIKEGKEYAEKMRNEIVTKAQEEAKKIAAQAKAEIEQEKQQALNALRDEVATLAVKGAEKIIRMNLDAEKHK 160
119358471 161 KIVDSMIQDLSTKRN 175
145220542 161 KVVDSMIADLSTKQN 175
78187938  161 KVVDSMIQDLSTNRN 175
78188050  161 KVVASMIQDMSSKRN 175
21672860  161 AVVNDMIKEMAASRN 175
189501405 161 NIVDSMIQELSQHRN 175
189347958 161 KIVDSMIRDLASKRN 175
194335033 161 AIVSSMIQDLSKHRN 175
194337849 161 KIVDSMIQDLSTKRN 175
193213684 161 AVVNDMINEMAAKRN 175
193215091 161 AVVEGMLEDLSTKRN 175
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap