Conserved Protein Domain Family
PRK14470

?
PRK14470: PRK14470 
ribosomal RNA large subunit methyltransferase N; Provisional
Statistics
?
PSSM-Id: 172945
View PSSM: PRK14470
Aligned: 5 rows
Threshold Bit Score: 562.628
Threshold Setting Gi: 108761479
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
153007216   1 MLHLLGQDSRALARKAGISLEDARRITGAVIGRGAP----LRSARNVRRAVLDRVEALATPGELRRVACTDAKDGFRRYL 76 
108761479   3 LKSLSLQELEAALAPLSPSPAAVRKVFAAVFAHGAQsvedVASARQVPRRVGDHLRAHAEMPKLAIVERRRADDGFVKYL 82 
86160645    1 -----------------------------MIGRGAP----LRDARNVRRSVLDEVDALATPGELRLLESVDAKDGFRKYL 47 
220919464   1 MLHLAGQDSRTLARRAGISLEDARRITGAVIGRGAP----LRDARNVRRSVLDEVDALATPGELRLLEAVDARDGFRKYL 76 
197124743   1 MLHLAGQDSRTLARRAGISLEDARRITGAVIGRGAP----LRDARNVRRSVLDEVDALATPGELRLLEAVDARDGFRKYL 76 
153007216  77 LELGDGARVEAVRIPLFDTHHTVCLSSQAGCALGCSFCATGALGLARSLRAWEIVAQLLHVRADSTRPITGVVFMGQGEP 156
108761479  83 FDSPLGGRIEAVRIPIFDEKYVICVSSQVGCALACDFCMTGKLGFKRNLQTWEILDQVLQVREEADRPVRGVVFMGMGEP 162
86160645   48 FELPDGLRVETVRIPLYDTHHVVCLSSQAGCALGCAFCATAKLGLDRSLRSWEMVSQLLAVRADSERPITGVVFMGQGEP 127
220919464  77 FELPDGLRVETVRIPLFDTHHVVCLSSQAGCALGCAFCATAKLGLDRSLRSWEMVAQLLAVRADSERPITGVVFMGQGEP 156
197124743  77 FELPDGLRVETVRIPLFDTHHVVCLSSQAGCALGCAFCATAKLGLDRSLRSWEMVSQLLAVRADSERPITGVVFMGQGEP 156
153007216 157 FLNYDAVLEAAYTLCDPAGGRIDGRRISISTAGVVPMIRRYTAEGHKFRLCVSLNAAIPWKRRALMPIEEGFPLDELVDA 236
108761479 163 LLNYKETLRAADILRHPAGFSIAGEAITFSTAGHVPAIRRYVREGHPYRLAFSVTSAIAEKRAKVLPIEKTHPLPELIAA 242
86160645  128 FLNYDEVLAAAYALCDPAGARIDARRISISTAGVVPMIRRYTAEGHKFRLCISLNAAMPWKRRALMPVEQGFPLDELVEA 207
220919464 157 FLNYDEVLTAAYALCDPAGARIDARRISISTAGVVPMIRRYTAEGHKFRLCISLNAAMPWKRRALMPVEQGFPLDELVEA 236
197124743 157 FLNYDEVLAAAYALCDPAGARIDARRISISTAGVVPMIRRYTAEGHKFRLCISLNAAMPWKRRALMPVEQGFPLDELVEA 236
153007216 237 VREHAAQ-RGRVTLEYVMIAGVNTGDEDAAALGRLLAGIPVRLNPIAVNDATGRHRPPDEAEWNAFRDALarELPGQPIV 315
108761479 243 IREYSEVrRERAMIAYVAISGFNMGREDAEALKVAFEGIRIKVDLIDVTDPTGKYLPPTPEELSAFRDHL--QILKSPVA 320
86160645  208 IREHAAL-RGRVTLEYVMISGVNVGEEDAAALGRLLAGIPVRLNPIAVNDASGRYRPPDEDEWNAFRDALarELPGTPVV 286
220919464 237 IREHAAL-RGRVTLEYVMISGVNVGEEDAAALGQLLAGIPVRLNPIAVNDASGRYCPPDEDEWNAFRDALarELPGTPVV 315
197124743 237 IREHAAL-RGRVTLEYVMISGVNVGEEDAAALGQLLAGIPVRLNPIAVNDASGRYRPPDEDEWNAFRDALarELPGTPIV 315
153007216 316 RRYSGGQDEHAACGMLSSRTR 336
108761479 321 RRYSGGKEIGAACGTLAATQY 341
86160645  287 RRYSGGQDEHAACGMLASRRR 307
220919464 316 RRYSGGQDEHAACGMLASRRR 336
197124743 316 RRYSGGQDEHAACGMLASRRR 336
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap