Conserved Protein Domain Family
PRK14469

?
PRK14469: PRK14469 
23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN
Statistics
?
PSSM-Id: 172944
View PSSM: PRK14469
Aligned: 11 rows
Threshold Bit Score: 604.429
Threshold Setting Gi: 239618306
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
154250366   2 RKNILDFSYEELVD-EFSKIGLEKFRVDQVWDWIYKKHEFDFDKMTNLSKEHRNTLSERFYIYVPELLDMQISQIDKTTK 80 
222099877   1 MKNLLDLSYDELVS-EITSLGLERYRADQILDWVFDKKVNNFDEMTNLSKQHRALLKEHFTIPFLKLLEKRVSKIDGTTK 79 
160903334   3 TKNILDFEYSDLQSyLLNELGLEKFRTDQICDWIYKKRVFDFESMTNLSKDDRQKLSDNFKISIPHIVKKEVSKIDGTTK 82 
170288910   1 MKNLLDLSYEELVA-EVTSLGLERYRADQILDWVFNKKVNNFDEMTNLSKQHRALLKEHFSIPFLKLLDKKVSRIDGTTK 79 
217077834   2 KKNILDFNYEELVN-EFKSLGLEKYRVDQVFDWIYKKKVFDFKDMTNLSKEHRRILDENFGIQIPKLLDMQISKIDRTTK 80 
150021379   1 MKNILDLKYEELVN-EFQRIGLEKYRVDQVLNWIYKKKVFEFEKMTNLSKEHRKLLSEKFFIDLPKLLDMQISKIDKTTK 79 
148270145   1 MKNLLDLSYEELIT-EITNLGLERYRADQILDWIFNKKVNNFDEMTNLSKKHRALLKEHFSIPFLKLLDKKVSRIDGTTK 79 
157364703   1 -MNILSMTYEKFVQ-KIQELGLEKYRADQILDWIYKKHVFVFEQMTNLSKQHRSLLRENFCIQIPKIVSKRVSSIDKTTK 78 
15644462    1 MKNLLDLSYEELVT-EITNLGLERYRADQILDWVFDKKVNNFDEMTNLSKKHRALLKEHFSISFLKLLDKKVSRIDGTTK 79 
239618306   1 -MQLLEMTLDELRK-VLVDEGYEKYRASQIFDWIYKKKVLNFSNMTNLPKDFRKFLSGTFRYPEMTIVRRSLSKIDGTEK 78 
281412513   1 MKNLLDLSYEELIT-EITNLGLERYRADQILDWIFNKKVNNFDEMTNLSKKHRALLKEHFSIPFLKLLDKKVSRIDGTTK 79 
154250366  81 FLWKLEDDNTIESVLLFHPDRVTACISTQVGCPAKCAFCATGQSGFVRNLSAGEIVSQIIAMEKHRKVNIGNIVYMGMGE 160
222099877  80 FLWELEDGNTIESVMIFHPGRITACISTQVGCPVGCTFCATGMSGFVRNLTTGEIVSQILSMEKEEGKKIGNVVYMGMGE 159
160903334  83 YLLELEDKNTVEAVIIYYPSRTIACISTQVGCPLKCSFCSTGQSGYVRNLSTGEIIGQLLAMEKDKEMDVKNVVYMGMGE 162
170288910  80 FLWELEDGNTIESVMLFHPDRITACISTQVGCPVKCIFCATGMSGFVRNLTTGEIVAQILSMEREEKKKIGNVVYMGMGE 159
217077834  81 FLWELPDGNTIESVALFHEGRVTACISTQVGCPVKCSFCATGQSGYVRNLTAGEIVSQILGIEVHRKIRVGNVVYMGMGE 160
150021379  80 FLWELRDGNTIESVALFHSGRVTACISTQVGCPVKCEFCATGQSGFVRNLTVGEIVSQILAIELNRKIKVGNVVYMGMGE 159
148270145  80 FLWELEDGNTIESVMLFHPDRITACISTQVGCPVKCIFCATGMSGFVRNLTTGEIVAQILSMEKEEKKKIGNVVYMGMGE 159
157364703  79 YLYELSDGNTIESVLLFHEGYATACISTQIGCPVKCSFCATGQSGFVRNLDAGEIVSQILAIEKDSKQTVRNIVYMGMGE 158
15644462   80 FLWELEDGNTIESVMLFHPDRITACISTQVGCPVKCIFCATGMSGFVRNLTTGEIVAQILSMEKEEKKKIGNVVYMGMGE 159
239618306  79 FLWKLHDGEFIESVILRHPDHTTFCISTQVGCQLGCIFCATGMSGFKRNLSVSEIVGQVIFMEKSMGKNVTNIVFMGMGE 158
281412513  80 FLWELEDGNTIESVMLFHPDRITACISTQVGCPVKCIFCATGMSGFVRNLTTGEIVAQILSMEKEEKKKIGNVVYMGMGE 159
154250366 161 PLLNYKEVVKSVKMLNHKKGKNISMRRISISTVGIPEKIVELAQDLPEVKLAISLHAPNNYKRDIIVPMNKKYSVEEIIQ 240
222099877 160 PLLNYENTIKSIRILNHKKMGNIGIRRITISTVGIPEKIIQLADEGLDVKLALSLHAPTNFKRDQLVPLNRKYSVEEILN 239
160903334 163 PLLNFNNVVQTIEILNHPKMKKLGARHITISTAGIPQKIEEVGDLNKEFRLSVSLHAPTNLQRDQIMPINHKYPVEQVIQ 242
170288910 160 PLLNYENTIKSIRILNHKKMGNIGIRRITISTVGIPDRIIQLAEEGLDVKLALSLHAPTNFKRDQLVPLNKKYSIEEILN 239
217077834 161 PLLNYENTIKSVKMLNNKKMFGIGIRRITISTVGVPEKIIDLAESGLDVKLALSLHATTNFKRDQIIPLNKQYSIEELIF 240
150021379 160 PLLNFENVIDSIKMLNDKKMLNIGIRRITVSTVGIPEKIIALAESGLNVKLALSLHAVTDYKRDQIIPLNKKYSVEELIY 239
148270145 160 PLLNYENTIKSIRTLNHKKMGNIGIRRITISTVGIPDRIIQLAEEGLDVKLALSLHAPTNFKRDQLVPLNKKYSIEEILN 239
157364703 159 PLLNYDNVIKSIKILIDKKTKNIGIRRVTLSTVGIPEMILKLSEERLDLNLAISLHASTNEKRDQIIPINRKYSIQEIIN 238
15644462  160 PLLNYENTIKSIRILNHKKMGNIGIRRITISTVGIPDRIIQLAEEGLDVKLALSLHAPTNFKRDQLVPLNKKYSIEEILN 239
239618306 159 PFLNTDNVFKSIEILHEPAGRNLGIRHFTISTAGIPEGIIRLADSGMDVRLSLSLHAATDEKRSMLMPINKRYNIQQLMA 238
281412513 160 PLLNYENTIKSIRTLNHKKMGNIGIRRITISTVGIPDRIIQLAEEGLDVKLALSLHAPTNFKRDQLVPLNKKYSIEEILN 239
154250366 241 SAKEYQKITKNRVTFEYILIREFNDFVDDAEKLAELLKGMGAYVNLIPVNPVPSSgelkFERPHHWAIERFKEVLDKHNI 320
222099877 240 AIKVYQMKTGKRVTIEYVLIRGVNDEISDAKKLAEILKGLKVFVNLIPVNPTVAG----LSKPSRQRILAFKRILLENGI 315
160903334 243 SCRIYQKKTKKRVTFEYILIKGFNDSKEDALKLVELFGDLKVMVNLIPVNENPAG----FEKPSKRFIQAFLDTLVKNGI 318
170288910 240 AVKIYQRKTGNRVTIEYVLIRGINDEISDAKKLAEILKNMKIFVNLIPVNPTAED----LKKPSRERLLAFKRILLENGI 315
217077834 241 AVKKYQEITNNRVTIEYILIKEFNDYPEDAEKLAELLKGLSVYVNLIPVNPVNPN----YYRPSRWAMERFKEILTKYGI 316
150021379 240 SLRKYQEITGNRVTIEYILIREFNDYPEDAIRLVELLRGLSVYVNLIPINPVNPK----FHRPNRWALERFKEILEKNGI 315
148270145 240 AVKIYQKKTGNRVTIEYVLIKGMNDEISDAKKLAEILKNMKVFVNLIPVNPTVED----LKKPSRERLLTFKRILLESGI 315
157364703 239 AAKNYQERSDRRLTIEYILIKEFNDFDEDARKLAKLLNGLKVFVNLIPVNSTFSN----FEKPAKWKINRFKEILINSGI 314
15644462  240 AVKIYQRKTGNRVTIEYVLIRGINDEISDAKKLAEILRNMKVFVNLIPVNPTVEG----LRRPSRERLLTFKRILLENGI 315
239618306 239 SLEYYQRKTNRRITIEYILIDGINDSIEDAKQLAKLFKHLKIFVNIIAINPVVPT----LKRPSREKVERFAIELKKHGI 314
281412513 240 AVKIYQKKTGNRVTIEYVLIKGMNDEISDAKKLAEILKNMKVFVNLIPVNPTVED----LKKPSRERLLTFKRILLESGI 315
154250366 321 ENEIRREKGTDIDAACGQLRRRYITNKK 348
222099877 316 EAEIRQEKGSDIEAACGQLRLKRKVSSP 343
160903334 319 DAVVRAEKGSDISAACGQLRTRELKEAN 346
170288910 316 EAEIRREKGSDIEAACGQLRLKRIKSTS 343
217077834 317 ECEIRAEKGTDIDAACGQLRRRNLK--- 341
150021379 316 ECEIRKEKGTDIDAACGQLRRRKLR--- 340
148270145 316 EAEIRREKGADIEAACGQLRLKRIKSTS 343
157364703 315 EAEIRYEKGADIEAACGQLRIRNLLSKQ 342
15644462  316 EAEIRREKGTDIEAACGQLRLKRIKSRS 343
239618306 315 EAAIRTEKGSDIDAACGQLRRKNLQEER 342
281412513 316 EAEIRREKGADIEAACGQLRLKRIKSTS 343
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap