Conserved Protein Domain Family
PRK14465

?
PRK14465: PRK14465 
23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN
Statistics
?
PSSM-Id: 172940
View PSSM: PRK14465
Aligned: 6 rows
Threshold Bit Score: 691.325
Threshold Setting Gi: 183220754
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
183220754   1 MKEEIPvLKGKTKKELEEICVSLGLEKYRAAQIYTGIYKSRYTTIDQFTTLSKEVREKLKEHTQYPEIEIGRDLVSKeDG 80 
189910855   1 MKEEIPvLKGKTKKELEEICVSLGLEKYRAAQIYTGIYKSRYTTIDQFTTLSKEVREKLKEHTQYPEIEIGRDLVSKeDG 80 
24213541   10 QTEKIP-LKGRTLKELSEIMITLGEKPFRAKQIYHGLYVNRYETWDQFTTFSKIFKEKLEELCSLTHLQVVKQLKSV-DG 87 
45658616   10 QTEKIP-LKGRTLKELSEIMITLGEKPFRAKQIYHGLYVNRYETWDQFTTFSKIFKEKLEELCSLTHLQVVKQLKSV-DG 87 
116328894  10 QTGKIP-LKGRTLKELSEIMVSLGEKSFRAKQIYHGLYVNRYESWEQFTTFSKTLKEKLEGLCSLTQLTVVKHLKSV-DG 87 
116330499  10 QTGKIP-LKGRTLKELSEIMVSLGEKSFRAKQIYHGLYVNRYESWEQFTTFSKTLKEKLEGLCSLTQLTVVKHLKSV-DG 87 
183220754  81 TRKFTFY--VGENKEIEAVWIPSGDGGRKTICISSQIGCTLNCKFCATGLLEYKGNLQTWQILDQVLQVERLVGDRATNI 158
189910855  81 TRKFTFY--VGENKEIEAVWIPSGDGGRKTICISSQIGCTLNCKFCATGLLEYKGNLQTWQILDQVLQVERLVGDRATNI 158
24213541   88 TQKFTFTseSGNGKEFEAVWIPSGDGGRKTICISSQIGCTLNCKFCATAKLEFQGNLKAHEIVDQILQVEKIVGDKATNV 167
45658616   88 TQKFTFTseSGNGKEFEAVWIPSGDGGRKTICISSQIGCTLNCKFCATAKLEFQGNLKAHEIVDQILQVEKIVGDKATNV 167
116328894  88 TQKFTFA--SEQGKEFEAVWIPSGDGGRKTICISSQVGCTLNCKFCATAKLEFQGNLKAHEIVDQVLQVEKIVGDNATNV 165
116330499  88 TQKFTFA--SEQGKEFEAVWIPSGDGGRKTICISSQVGCTLNCKFCATAKLEFQGNLKAHEIVDQVLQVEKIVGDNATNV 165
183220754 159 VFMGMGEPMHNYFSVMKAAHILRDKDAFGLGALRITISTAGVTTGINRFIENKEPFNFAISLNHPNPNARSSVMDVNDKH 238
189910855 159 VFMGMGEPMHNYFSVMKAAHILRDKDAFGLGALRITISTAGVTTGINRFIENKEPFNFAISLNHPNPNARSSVMDVNDKH 238
24213541  168 VFMGMGEPLHNYFNVIRAASIFHDPDAFNLGAKRITISTSGVVNGIRRFIENKEPYNFAISLNHPDPKGRLQIMDIEEKF 247
45658616  168 VFMGMGEPLHNYFNVIRAASIFHDPDALNLGAKRITISTSGVVNGIRRFIENKEPYNFAISLNHPDPKGRLQIMDIEEKF 247
116328894 166 VFMGMGEPFHNYFNVIRAASILHDPDALNLGAKRITISTSGVVNGIRRFIENKEPYNFAISLNHPDPNGRLQIMDIEEKF 245
116330499 166 VFMGMGEPFHNYFNVIRAASILHDPDALNLGAKRITISTSGVVNGIRRFIENKEPYNFAISLNHPDPNGRLQIMDIEEKF 245
183220754 239 PLEKLIDSAKRFTKELDRAITFEYVMIPDVNMGRDNAERLAKIARSVNkCKINVIPLNTDFTGWRRPTDDEVKDFVMHLK 318
189910855 239 PLEKLIDSAKRFTKELDRAITFEYVMIPDVNMGRDNAERLAKIARSVNkCKINVIPLNTDFTGWRRPTDDEVKDFVMHLK 318
24213541  248 SLPELLQAAKDFTRELKRRITFEYVMIPGVNMGFENANKLVKIAKSLD-CKINVIPLNTEFFGWRRPTREEIAEFIALLE 326
45658616  248 SLPELLQAAKDFTRELKRRITFEYVMIPGVNMGFENANKLVKIAKSLD-CKINVIPLNTEFFGWRRPTREEIAEFIALLE 326
116328894 246 ALSELLQAAKDFTRELKRRITFEYVMIPGVSMGPENANKLVKIARSLD-CKINVIPLNTEFFGWRRPTKQEVAEFITLLE 324
116330499 246 ALSELLQAAKDFTRELKRRITFEYVMIPGVSMGPENANKLVKIARSLD-CKINVIPLNTEFFGWRRPTKQEVAEFITLLE 324
183220754 319 AkTTAPILNRRSPGRDINGACGMLALKG 346
189910855 319 AkTTAPILNRRSPGRDINGACGMLALKG 346
24213541  327 P-AGVPILNRRSPGKDIFGACGMLASKS 353
45658616  327 P-AGVPILNRRSPGKDIFGACGMLASKS 353
116328894 325 P-AGVPILNRRSPGKDIFGACGMLASKS 351
116330499 325 P-AGVPILNRRSPGKDIFGACGMLASKS 351
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap