Conserved Protein Domain Family
PRK14460

?
PRK14460: PRK14460 
23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN
Statistics
?
PSSM-Id: 172935
View PSSM: PRK14460
Aligned: 10 rows
Threshold Bit Score: 646.794
Threshold Setting Gi: 239904707
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
94987122    1 MINLLNITYPEFESLIVTTLQEKTYRAMQIWQWVWQKQITDIESMTNLPQKIRASLTALIKINLPEIVTIQQSSDGTKKF 80 
78358007    1 MVDILNLTFEELETFLVEKLGEKKFRARQIWQWLWNKYVRDFDQMTNVSKQTRAQLKEHARIFWPEVVTTSKSQDGTTKF 80 
120601511   1 MTDILNLTYEELEAFMTAELGEPRFRARQVWQWLWQKCARSFDEMTNVSKATRARLAEKAVITWPEVETVQKSADGTTKF 80 
46581308    1 MTDILNLTYEELEAFMTAELGEPRFRARQVWQWLWQKCARSFDEMTNVSKATRARLAEKAVITWPEVETVQKSADGTTKF 80 
218886526   1 MIDILNLTYDELEAWMTGTLGEPRFRARQVWQWLWQKNARSFDAMTNVSKATRARLAEAARITWPEVRTVKTSSDGTVKF 80 
220903723  23 MTNLLNLTLPELEAWTQSELGEPKFRAMQLWQWIWQRMARDFDTMTNISRPCRELLAAKACIVWPEVSAVEESRDGTTKF 102
239904707   1 MTNLIDLTFHELESLIV-SLGEPPYRARQVWQWLWQKRCREIAGMTDVSKALRARLEEVAEIRWPVVEMVRESRDGTVKF 79 
242277580   7 MIDILDLEYSELESFVSQELKAPRFRTDQIWQWLWQKGVEDFDSMTNLAKNLRDELKAKAVINHPQVDVVQTSKDGTIKL 86 
256830852   1 MRNILELTCPELEEAVQ-AMGHQSFRARQLWQWLWRKGVREFSAMTNLARDFREQLMREWALDWPEVHEVQTSSDGTVKL 79 
258406363   3 PKTIHDISFDDLAAWLT-EQGQPRFRAEQIWQWLWIKGATSFEDMTNVSKSLRSALSQVFPIALPTVAEVHTSADGTRKF 81 
94987122   81 LLRLSDGALIETVLIPSIDKagniRITQCLSSQVGCSMGCTFCSTATMGFIRNLTAGEIVSQVLLAKLHLNDNkPDKPII 160
78358007   81 LLRLADGALVETVLIPGSQG----RITQCLSCQVGCAMGCTFCATGTLGFERNMTMSEILGQVLVAREYLNDV-AERPIL 155
120601511  81 LLRLADGALVETVLIPSASRegtlRITQCLSCQVGCAMGCTFCSTGTMGFERNMTMGEILGQVLVARAHLGDSrPDHPIL 160
46581308   81 LLRLADGALVETVLIPSASRegtlRITQCLSCQVGCAMGCTFCSTGTMGFERNMTMGEILGQVLVARAHLGDSrPDHPIL 160
218886526  81 LLALADGALVETVLIPSESRegkvRMTQCLSCQVGCAMGCTFCSTGSMGFERNMTMAEILGQVLVAREHLGDDrPDHPIV 160
220903723 103 LLRLEDGAQIETVLIPSDSRegvrRWTQCLSCQVGCTMGCTFCSTGQMGFERNMTMGEILGQILVAREHLGDTrLHWPIL 182
239904707  80 LLALDDGERVECVLIPEKD-----HYTACLSTQVGCAMGCGFCATGMLGFRRNMTPGEMLGQVLVGRQYLTDKgVELG-L 153
242277580  87 LLRLKDGALVETVLIPMEG-----RYTQCLSTQVGCAMACTFCNTGLMGFERNMSMSEMLGQVLAGRKYLRENnLDP--L 159
256830852  80 LLRLADGALVETVLIPDKE-----RYTQCLSCQIGCPMGCTFCSTGLMGFSRNMTGGEIAAQVLVARDYLRAHgLGDE-V 153
258406363  82 LLNLHDGHVLETVLIPGGE-----HFTQCLSTQVGCNLGCTFCSTGQMGLTRNLSAAEIAGQVIVARNHLWQTgTGMR-L 155
94987122  161 RNIVFMGMGEPLLNLTELTRALHILHSEKGLNFSARRITVSTCGI-KKGIQALSENGLAFLALSLHASNQELRSTIMPKA 239
78358007  156 RNLVFMGMGEPLLNLDEIMRSLHTLNSELGLQFSPRRITVSTCGVnPEGLRRLGESGLAYLAVSLHAPTQELRRTIMPKA 235
120601511 161 RNLVFMGMGEPLLNLNEVMRSLRTLNDEFGLSFSPRRITVSTCGI-EKGLRELGESGLAFLAVSLHAPNQEIRKRIMPKA 239
46581308  161 RNLVFMGMGEPLLNLNEVMRSLRTLNDEFGLSFSPRRITVSTCGI-EKGLRELGESGLAFLAVSLHAPNQEIRKRIMPKA 239
218886526 161 RNLVFMGMGEPLLNLNEVMRSLRTLNDEFGLCFSPRRITVSTCGI-EKGLRELGESGLAFLAVSLHAPNQEVRARIMPRA 239
220903723 183 RNLVFMGMGEPLLNLKEVMRSLESLNNDKGLGFSPRRITVSTCGI-EKGLKELGESGLAFLAVSLHAPNQAVRERIMPKA 261
239904707 154 RNLVFMGMGEPLLNYENLLKTLEALHHPQGLDFSGRRITVSTAGV-ARHLLDLGRTGLCSLAISLHAPTQAQRERIMPGA 232
242277580 160 KNLVFMGMGEPLLNLDNLIRTLRNLNNQDGLSFVPRRITVSSVGF-VKQLEELGKTGLTLPAISLHAPTQELREKIMPKA 238
256830852 154 KNLVYMGMGEPLTNWDEVRRSLQILSNAEGLEFSRRRITLSTCAI-KGKMDVFGIEGLALPAISLHAPTQEIRESLMPGA 232
258406363 156 RNLVFMGMGEPLLNWENVDNALDRLIHASAMNFSPRRVTVSTVGV-PGTLDALGHSHKASLAVSLHAPNQELREKIMPRA 234
94987122  240 AK-WDLKELIDTLKNYSLKKREKITFEYLLLGGINDSPEHAKELAKLITDIKGKLNLIPYNPA--QGQPYLKPTEENILK 316
78358007  236 AR-WELNDFIEALQSYPLKTRERITFEYLLLGGVNDSLEHAKQLVRLVSRTKAKLNLIVYNPSgdEADPYAAPTEERILA 314
120601511 240 AH-WHLDDLITALESYPLKTRERVTFEYLLLGGVNDGIEHARELVRLVSRTKGKLNLIVYNPA--EGDPYDAPTPERILA 316
46581308  240 AH-WHLDDLITALESYPLKTRERVTFEYLLLGGVNDGIEHARELVRLVSRTKGKLNLIVYNPA--EGDPYDAPTPERILA 316
218886526 240 AR-WTLDDLMAALESYPLKTRERITFEYLLLGGVNDSIDHARELVRLVSRTKAKLNLIVYNPA--EGLPYEAPSQARILA 316
220903723 262 AR-WRLNDLMAALKSYPLKTREHITFEYLMLGGVNDSLEHARELAPLVSAVKGKLNIIVYNAA--EGSPYQAPSEERILA 338
239904707 233 AR-LELDKLMDLLAQYPLKPRERLTFEYLLLAGVNDADADARELVRLLSRVKAKVNLIVFNAT--PGLPYSPPDEARVLA 309
242277580 239 AK-THIEDLLAAMDRFPLKPREKVTYEYLLLGGVNDSIEHAKQLVKLLGHRRCKVNLIAYNPG--DEPLYKAPTREKVLA 315
256830852 233 AR-WPIEELIAALQGMELKARERVTIEYILIKGVNDSLQHARQLVRLLSHLKCKINLIAYNPG--PGIEYAAPAPGDVLA 309
258406363 235 ARmLPLPDLLARLRSYPMAPRQRVTIEYVLLGGVNDSLDQARQLVRCLNGIRCKVNLIAFNPC--PGLPYSAPETEQVLA 312
94987122  317 FQKVLWSKGIVTILRKSKGQDINAACGQLKTTYLSQSSSTIY 358
78358007  315 FEQYLWSKHVTAIIRKSKGADIKAACGQLKAAETGGTPCCAQ 356
120601511 317 FEQYLWSKNITAIIRKSKGQDIKAACGQLKASELQRGTASAG 358
46581308  317 FEQYLWSKNITAIIRKSKGQDIKAACGQLKASELQRGTASAG 358
218886526 317 FEQYLWSKNVTAIIRKSKGQDIKAACGQLKASELAELAGMAV 358
220903723 339 FEKYLWSKDITAIIRKSKGQDIKAACGQLKAARQKDTAAADA 380
239904707 310 FQDILKSKGLTATLRKSKGSDIAAACGQLRAECDGEGEGEGK 351
242277580 316 FEKYLWDKKITATIRRSMGQDIKAACGQLKADQQKK------ 351
256830852 310 FEELLRKKGFTVTLRKSKGQDIAAACGQLKTEAQGRMNSTTS 351
258406363 313 FETLLRDKGLTATLRKSKGQDISAACGQLKTRRTAGANNCGP 354
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap