Conserved Protein Domain Family
PRK14456

?
PRK14456: PRK14456 
23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN
Statistics
?
PSSM-Id: 172932
View PSSM: PRK14456
Aligned: 4 rows
Threshold Bit Score: 666.191
Threshold Setting Gi: 21674009
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
21674009    1 MEKNEISEERRTQEKEKQhghrlNIRRLGRKELTELLTRLGEPAYRANQLHRWLYSNQALRFEEMSTLSKQLRQKLASEW 80 
193212778   1 MPEPSFSGASKPFDDALP-----NIRELNRQELEHLMQRLGQPAYRARQLHQWLYSHQALSFEDMTSFGKKLREQLAGSW 75 
145219757   1 MRSPQTSEKTHTMAKTLQ-----NITDLTLQQLTGRLAEMKEPAWRAKQIHEWLFSHRAESFEEMTTLSKALRKALEETF 75 
78186813    1 ------------MKRERS-----NILNLRMDELKEALAAINEPQWRAAQLHQWLFSHRAGSFDDMTTLSLPLRRKLAESF 63 
21674009   81 IIHPASlvgTERETTDASLVTGNPTAKFLIKLEDNELVESVLIPSEERITACISSQIGCPLRCTFCATGHMGFRRNLTAS 160
193212778  76 AIRPATldaTETEPAQCAAPGAIPTSKFLVKLDDGVLIESVLIPSEERMTACISSQVGCALRCTFCATGQMGFKRDLVAP 155
145219757  76 AITPPE---VEQHDNSTEGACPGPTEKLLLRLPDGAMIETVLIPGPGRLTACLSSQAGCALQCSFCATGSLGFKRNLTPG 152
78186813   64 YIQQPV---TEKHDETMEGSPAGATEKLLIQLPDGERVETVLIPGPNRMTACVSAQAGCLLGCSFCATGQMGFRRNLSSG 140
21674009  161 EITDQVFLLEKE-AQKRHWRGLTNIVFMGMGEPLLNLDNVLESIGTLTEKDYQFSISERKITISTVGLPVEMDRIARSGL 239
193212778 156 EITDQVFLLQQE-AHRLYGRGITNTVFMGMGEPLLNLDNVFESISTLTEQEYRFSISERKITISTVGLVPEIGRIATSGL 234
145219757 153 EITGQANALNSMlAASGREQKITNIVFMGMGEPLLNTLNVFDAVETLSTRGYTSSISQRKITISTVGIIPEIAKLATSGM 232
78186813  141 EITGQVWALSDMlQERNREASISNIVFMGMGEPLLNTANVIEAVLNLSTRKYRFSTSQRKITISTVGITPEIDRLADTGL 220
21674009  240 KTKLAISLHSADQLIRERMMPIAA-DITLDKLAKAINSYNSVTSQPVTLVYMLLEGINDSPEDARKLVRFAKRVLCKINL 318
193212778 235 KTKLAISLHSADQATRERMMPVAA-DYPLDELSRAISAYNTKTGQPVTLVYMLLEGINDAPEDARKLARFAKRGLCKINL 313
145219757 233 KTKLAVSLHSAFQEKRESLMPLAArRYPLDELQPVLAHYAKNTGEPVTLVYMLLEGVNDTLEDARQLIRFASRFFCKINL 312
78186813  221 KTKLAVSLHSAIQEKREALMPQAArQYPLDRLRESLIGYASKTGEPVTLAYMLLKGINDSEMDAKRLIRYASGFFCKINL 300
21674009  319 IDYNSIVTLKFKPGCSSSKTMFIQQLLDAGLLVTVRKSQGATINAACGQLATRPVR 374
193212778 314 IDYNAIVNLKFRPGYGSAKSMFIERLLDAGLHVTVRKSQGATINAACGQLATRSGN 369
145219757 313 IDYNSIVNIPFQSVCSETRDRFRDRLLEAGLQVTLRKSYGTSIHAACGQLAAKGME 368
78186813  301 IDYNPIVNIKFEPVCDGTRERFRDILQDAGLQVTIRKSYGTPINAACGQLAADCTG 356
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap