Conserved Protein Domain Family
PRK14448

?
PRK14448: PRK14448 
acylphosphatase; Provisional
Statistics
?
PSSM-Id: 172924
View PSSM: PRK14448
Aligned: 8 rows
Threshold Bit Score: 157.999
Threshold Setting Gi: 165975599
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
190149414  1 MQQKLFIVTGHVQGVGFRFFTLQEAGKIGIKGYVKNRPEGSVEVVAVGSDAQMAAFRNWLQKGPPTSVVCNLIEQSYQGS 80 
165975599  1 MQQKLFIVTGHVQSVGFRFFTLQEAGKIGIKGYVKNRPEGSVEVVAVGSDAQMAAFRNWLQKGPPTSVVCNLIEQSYQGS 80 
15602261   9 MLKKQFIVYGLVQGVGFRYFTWKTAMQIGVKGYVRNRDDGSVEVVAVGSTTQLAQLHTWLTQGPRTASVEQVIEQEYADS 88 
52424900   5 MLKKQFVVYGIVQGVGFRYFTWKKATEIGLNGIVKNQRDGSVYILAEGSASQIDSFRDWLSHGPPSARVDRVEENDYSGT 84 
126207631  1 MQQKLFIVTGHVQSVGFRFFTLQEAGKIGIKGYVKNRPEGSVEVVAVGSDAQMAAFRNWLQKGPPTSVVCNLIEQSYQGS 80 
152978677  1 MIQRQFTVYGCVQGVGFRFFTAREANKLGIQGYVKNQADGSVRVVAAGSDRQVAAFRDWLEQGPPTAEVTNLLEQEYTGG 80 
251792185  1 MQKKRFLVYGRVQGVGFRYFTWNEAQKIGVLGFVRNLWDGSVEVVACGTEAQIEAFSAWVHHGPRTAKVTQVFVEDYLSE 80 
261868306  1 MLKKRFLVYGCVQGVGFRYFTWQQATKIGVTGFVRNLADGSVEVVAIGSEVQIQALSDWLHHGPRTATVQQVFAEDYLSS 80 
190149414 81 EQFEHFEIRR 90 
165975599 81 EQFEHFEIRR 90 
15602261  89 REFTDFSVRY 98 
52424900  85 HSFGLFSVEH 94 
126207631 81 EQFEHFEIRR 90 
152978677 81 RVFSDFTIER 90 
251792185 81 REFTEFQVLH 90 
261868306 81 KVFTTFQVLH 90 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap