Conserved Protein Domain Family
PRK14447

?
PRK14447: PRK14447 
acylphosphatase; Provisional
Statistics
?
PSSM-Id: 172923
View PSSM: PRK14447
Aligned: 5 rows
Threshold Bit Score: 159.331
Threshold Setting Gi: 119872793
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
119872793   1 MENVRAHLYIKGKVQGVFFRQSMKEIAVRYGVRGWVRNRSDGRTVEAVLEGPRDAVAKVIEWAKVGPPGARVEEVEVDWE 80 
145590563   1 MEMARAHLFIRGKVQGVFFRQSMKEVATRNGVRGWVRNRSDGRTVEAVLEGPRDAVLKVIEWARVGPPGARVEDVEVRWE 80 
126459401  16 VELVRAHIFVRGKVQGVFFRQSMKDVANKYGVKGWVRNRRDGRTVEAVLEGPKDAVLKVIEWARVGPPGARVEDLEVKWE 95 
18312492    1 MEMARAHVFIRGKVQGVFFRQSMKEVAMRNGVKGWVRNRSDGKTVEAVLEGPRDAVMKVLEWARIGPPGARVEDIEVQWE 80 
171184735   1 MDHVRAHLYIRGKVQGVFFRQSMREVAARNGVRGWVRNRSDGRTVEAVLEGPRDAVAKVIEWAKVGPPGARVEDVEVTWE 80 
119872793  81 EYKGEFQDFRILPTV 95 
145590563  81 EYKGEFQDFRILPTF 95 
126459401  96 EYKGEFNDFSILPTE 110
18312492   81 EYKGEFKDFKILPTV 95 
171184735  81 EYRGEFTDFRILPTE 95 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap