Conserved Protein Domain Family
PRK14446

?
PRK14446: PRK14446 
acylphosphatase; Provisional
Statistics
?
PSSM-Id: 172922
View PSSM: PRK14446
Aligned: 7 rows
Threshold Bit Score: 142.163
Threshold Setting Gi: 78046526
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
188992883  1 MQAARFIVTGVVQGVFFRASTRERALALQLRGHARNQADGSVEVVAAGSAAALEALEHWLWQGSPASKVASVTRTPCAIP 80 
188575460  1 MQAARFVVSGVVQGVWYRASTRERAVALGLVGHARNQTDGSVEVVAAGSAAALGALEAWLWQGPPAATVEAVTRTPCAVP 80 
21230336   1 MQAARFIFTGVVQGVFFRASTRERALALQLRGHARNQADGSVEVVAAGSAAALEALEHWLWQGSPASKVASVTRTPCAIP 80 
58583236   2 MQAARFVVSGVVQGVWYRASTRERAVALGLVGHARNQTDGSVEVVAAGSAAALGALEAWLWQGPPAATVEAVTRTPCAVP 81 
66769670   1 MQAARFIFTGVVQGVFFRASTRERALALQLRGHARNQADGSVEVVAAGSAAALEALEHWLWQGSPASKVASVTRTPCAIP 80 
84625072   1 MQAARFVVSGVVQGVWYRASTRERAVALGLVGHARNQTDGSVEVVAAGSAAALGALEAWLWQGPPAATVEAVTRTPCAVP 80 
78046526   1 MQAARFVVSGVVQGVWYRASTRQRAVALGLVGHARNQADGSVEVVAAGSAAALDALEAWLWQGPPAATVAAVTRTACAVP 80 
188992883 81 TTEAFVTG 88 
188575460 81 PTEDFVTG 88 
21230336  81 TTEAFVTG 88 
58583236  82 PTEDFVTG 89 
66769670  81 TTEAFVTG 88 
84625072  81 PTEDFVTG 88 
78046526  81 PTEDFVTG 88 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap