Conserved Protein Domain Family
PRK14445

?
PRK14445: PRK14445 
acylphosphatase; Provisional
Statistics
?
PSSM-Id: 172921
View PSSM: PRK14445
Aligned: 5 rows
Threshold Bit Score: 156.928
Threshold Setting Gi: 119358443
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
119358443  2 PMERNVRLMVSGSVQSVGYRMFIHKAAGELNLSGWVRNLMDGSVEIEVQGSSGMIDELVKRAERGPGRSSVTKVMVEELS 81 
21672967   1 MTEKRVHIIVSGLVQGVGFRMFVLREASARSLSGWTRNLPDGTVEVEAQGDSGRVDELIRQIRIGPSRSSVTSIKVKEIE 80 
194336030  1 -MQKRVNLIVTGAVQGVGFRMFIDRKANELKLVGWVRNRFDGTVEIEAQGPENAIEELLPQAQRGPSRSMVTAIRKEEKE 79 
193211747  1 MTEKRVHIIVRGLVQGVGFRMFVHREASARNLAGWTRNLPDGTVEIEAQGNAGMVDELVKQARIGPSRSQVNSIAVREIA 80 
189345642  1 -MTRRVHLIVSGRVQSVGFRMFIDRAARELQLSGWVKNLTGGNVEVNAQGAAPMIDELIKRAETGPSKSQVTGISIRELE 79 
119358443 82 LDPLKKGFSIR 92 
21672967  81 VDTSCREFRIL 91 
194336030 80 PDSTLERFNII 90 
193211747 81 PDNAENDFSIR 91 
189345642 80 PDSSLSGFSVI 90 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap