Conserved Protein Domain Family
PRK14444

?
PRK14444: PRK14444 
acylphosphatase; Provisional
Statistics
?
PSSM-Id: 172920
View PSSM: PRK14444
Aligned: 6 rows
Threshold Bit Score: 168.91
Threshold Setting Gi: 148654488
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
219847697  1 MDIVRAHVFISGRVQGVSFRAYTRDRAREANVKGWVRNLSDGRVEAVFEGSRPAVQKLISWCYSGPSQARVERVEVHWEE 80 
163849122  1 MDLVRAHVFISGRVQGVSFRAYTRDRAREAQVKGWVRNLSDGRVEAVFEGTRPAVQKLISWCYSGPSQAQVERVEVHWEE 80 
159899960  1 METTRAHVIVTGTVQGVNFRATCRDQARLAKIGGWVKNLPDGSVEAIFEGSQAGVQRMISWCYSGPIHAKVQHVEVTWQE 80 
222527095  1 MDLVRAHVFISGRVQGVSFRAYTRDRAREAQVKGWVRNLSDGRVEAVFEGTRPAVQKLISWCYSGPSQAQVERVEVHWEE 80 
148654488  2 MDMARAHVFISGRVQGVNFRASARNYAREVGVSGWVRNLEDGRVEAVFEGERSAVQKMVSWCYSGPSHARVEAVDVRWEK 81 
156740262  2 IDMARAHVFISGRVQGVNFRASARTYAREIGVSGWVRNLEDGRVEAVFEGARPAVQRMVSWCYSGPAHARVDAVDVHWEK 81 
219847697 81 PTGQESTFTIVW 92 
163849122 81 PTGKEGIFTIVW 92 
159899960 81 PTHREPTFDIAW 92 
222527095 81 PTGKEGIFTIVW 92 
148654488 82 PTGEERGFSIIW 93 
156740262 82 PTGEEREFSIIW 93 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap