Conserved Protein Domain Family
PRK14443

?
PRK14443: PRK14443 
acylphosphatase; Provisional
Statistics
?
PSSM-Id: 172919
View PSSM: PRK14443
Aligned: 9 rows
Threshold Bit Score: 175.635
Threshold Setting Gi: 289434663
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
16800486   1 MARDTAILRVTGFVQGVGFRYTTKHVAYKYDISGTVKNLDDGSVEIHAIAEEENLNKFIDAIKKGPSPGCRIEHVYIYKG 80 
16803421   1 MARDTAILRVTGFVQGVGFRYTTKHVAYKYDISGTVKNLDDGSVEIHAIAEEENLNKFIDAIKKGPSPGCRIEHVYIYKG 80 
46907609   1 MARDTAILRVTGFVQGVGFRYTTKHVAYKYDISGTVKNLDDGSVEIHAIAEEENLNKFIDAIKKGPSPGCRIEHVYIYKG 80 
116872813  1 MARDTAILRVTGFVQGVGFRYTTKHVAYKYDVSGTVKNLDDGSVEIHAIAEEENLNKFIDAIKKGPSPGCRIEHVYIYKG 80 
226223982  1 MARDTAILRVTGFVQGVGFRYTTKHVAYKYDISGTVKNLDDGSVEIHAIAEEENLNKFIDAIKKGPSPGCRIEHVYIYKG 80 
217964472  1 MARDTAILRVTGFVQGVGFRYTTKHVAYKYDISGTVKNLDDGSVEIHAIAEEENLNKFIDAIKKGPSPGCRIEHVYIYKG 80 
284994909  1 MARDTAILRVTGFVQGVGFRYTTKHVAYKYDISGTVKNLDDGSVEIHAIAEEENLNKFIDAIKKGPSPGCRIEHVYIYKG 80 
284801767  1 MARDTAILRVTGFVQGVGFRYTTKHVAYKYDISGTVKNLDDGSVEIHAIAEEENLNKFIDAIKKGPSPGCRIEHVYIYKG 80 
289434663  1 MARDTAILRVTGFVQGVGFRYTTKHVAYKYDISGTVKNLDDGSVEIHAIAEEDNLARFIDAIKKGPSPGCRIEHVYIYKG 80 
16800486  81 APVEDRKTFDIVY 93 
16803421  81 APVEERKTFDIVY 93 
46907609  81 APVEERKTFDIVY 93 
116872813 81 APVEDRKTFDIVY 93 
226223982 81 APVEERKTFDIVY 93 
217964472 81 APVEERKTFDIVY 93 
284994909 81 APVEERKTFDIVY 93 
284801767 81 APVEERKTFDIVY 93 
289434663 81 APVEERKTFDIIY 93 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap