Conserved Protein Domain Family
PRK14442

?
PRK14442: PRK14442 
acylphosphatase; Provisional
Statistics
?
PSSM-Id: 172918
View PSSM: PRK14442
Aligned: 5 rows
Threshold Bit Score: 124.989
Threshold Setting Gi: 226945727
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
218893075  1 MARICLHAYVGGRVQGVGFRQATREEADRLELDGWVRNLDDGRVEVVWEGEEDRAKALERWLGRGPRHAEVSAVEVEQMP 80 
226945727  1 MARIGLRALVSGRVQGVCYRQGTALQAERLALAGWVRNLADGRVEAWVEGEEAAVRELAEWLWRGPEQARVEGVELEEVG 80 
116048879  1 MARICLHAYVGGRVQGVGFRQATREEADRLELDGWVRNLDDGRVEVVWEGEEDRAKALERWLGRGPRHAEVSAVEVDQMP 80 
152988018  1 -----MHAYVGGRVQGVGFRQSTRDEAERLGLDGWVRNLEDGRVEVLWEGEEEQVKALQRWLERGPRRARVAGVEVEALP 75 
15596151   1 MARICLHAYVGGRVQGVGFRQATREEADRLELDGWVRNLDDGRVEVVWEGEEDRAKALERWLGRGPRHAEVSAVEVEQMP 80 
218893075 81 LQGIAGFVVRR 91 
226945727 81 LQGFSEFRVRR 91 
116048879 81 LQGIAGFVVRR 91 
152988018 76 LQGIAGFIVRR 86 
15596151  81 LQGIAGFVVRR 91 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap