Conserved Protein Domain Family
PRK14441

?
PRK14441: PRK14441 
acylphosphatase; Provisional
Statistics
?
PSSM-Id: 172917
View PSSM: PRK14441
Aligned: 4 rows
Threshold Bit Score: 142.426
Threshold Setting Gi: 153003608
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
153003608  1 MAELARAHILVSGEVQGVSFRAAAVDEARRLGVRGWVRNVADGRVEAEAEGERAKVEALVRWCGRGPPAARVADVQVSWG 80 
86157122   1 MADRVRARIVVSGRVQGVAFRQSAADEGRRLGVKGWVRNLPDGRVEAEVEGERAAVGALVRWCHAGPPAARVDGVEVEWV 80 
220915847  1 MADRVRARIVVSGRVQGVAFRQSTADEARRLGVEGWVRNLPDGRVEAEAEGGRTAVGALVRWCHAGPPAARVDRVEVEWV 80 
197121146  1 MADRVRARIVVSGRVQGVAFRQSTADEARRLGVEGWVRNLPDGRVEAEVEGDRAAVGALVRWCHAGPPAARVDRVEMEWV 80 
153003608 81 AYGGDLGPFSVRH 93 
86157122  81 DPAGDLGAFEIRF 93 
220915847 81 EPAGGLGAFEIRF 93 
197121146 81 EPAGCLGAFEIRF 93 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap