Conserved Protein Domain Family
PRK14440

?
PRK14440: PRK14440 
acylphosphatase; Provisional
Statistics
?
PSSM-Id: 172916
View PSSM: PRK14440
Aligned: 11 rows
Threshold Bit Score: 158.053
Threshold Setting Gi: 229579118
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
229579118   1 MLKRMYARVYGLVQGVGFRKFVQIHAIRLGIKGYAKNLPDGSVEVVAEGYEEALSKLLERIKQGPPAAEVEKVDFSFSEY 80 
229584809   1 MLKRMYARVYGLVQGVGFRKFVQIHAIRLGIKGYAKNLPDGSVEVVAEGYEEALSKLLERIKQGPPAAEVEKVDFSFSEY 80 
229582141   1 MLKRMYARVYGLVQGVGFRKFVQIHAIRLGIKGYAKNLPDGSVEVVAEGYEEALSKLLERIKQGPPAAEVEKVDFSFSEY 80 
227830293   1 MLKRMYARVYGLVQGVGFRKFVQIHAIRLGIKGYAKNLPDGSVEVVAEGYEEALSKLLERIKQGPPAAEVEKVDFSFSEY 80 
227827605   1 MLKRMYARVYGLVQGVGFRKFVQIHAIRLGIKGYAKNLPDGSVEVVAEGYEEALSKLLERIKQGPPAAEVEKVDFSFSEY 80 
15897775   12 MLKRMYARVYGLVQGVGFRKFVQIHAIRLGIKGYAKNLPDGSVEVVAEGYEEALSKLLERIKQGPPAAEVEKVDYSFSEY 91 
15921497    1 MLKRMYVKVYGIVQGVGFRRYVQIHAARLGIKGYAKNLPDGSVEIVAEGYEEALQKLLEYIKRGPPLSRVEKIEYRFYEY 80 
70607173    3 GLKRMYVIVYGIVQGVGYRRFIQIHAARLGIKGYAKNLPDGSVEILAEGYEEALYKLLDQIKRGPPLSKVEKVDVKFDDY 82 
146304455   2 GLARLHAIVEGEVQGVGFRRYVQIHAVRLGLKGYAKNLPDGTVEVVAEGYEESIQQFLNYLWKGPPLALVTKVTHKLESY 81 
238619763   1 MLKRMYARVYGLVQGVGFRKFVQIHAIRLGIKGYAKNLPDGSVEVVAEGYEEALSKLLERIKQGPPAAEVEKVDFSFSEY 80 
284997716   1 MLKRMYARVYGLVQGVGFRKFVQIHAIRLGIKGYAKNLPDGSVEVVAEGYEEALSKLLERIKQGPPAAEVEKVDFSFSEY 80 
229579118  81 KGEFEDFETY 90 
229584809  81 KGEFEDFETY 90 
229582141  81 KGEFEDFETY 90 
227830293  81 KGEFEDFETY 90 
227827605  81 KGEFEDFETY 90 
15897775   92 KGEFEDFETY 101
15921497   81 KGEFNNFDTY 90 
70607173   83 TGEFASFDTY 92 
146304455  82 KGEFTSFDTY 91 
238619763  81 KGEFEDFETY 90 
284997716  81 KGEFEDFETY 90 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap