Conserved Protein Domain Family
PRK14438

?
PRK14438: PRK14438 
acylphosphatase; Provisional
Statistics
?
PSSM-Id: 172914
View PSSM: PRK14438
Aligned: 4 rows
Threshold Bit Score: 168.865
Threshold Setting Gi: 148263372
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
222055065  1 MKIRAMVTITGLVQGVAFRQSTQQTAQRLNVCGWVKNLPDGSVQGCFEGEETDVETLIGWCHEGPSRAEVSGVNVKKEPF 80 
39995995   1 MKIRAIVTIKGLVQGVAFRHHTVQQAQRLGVSGWVKNLAGGDVQGCFEGEEEAVDALVAWCHHGPSRARVDRVILEREHY 80 
148263372  1 MKIRAMVTVKGMVQGVNFRRYTQQTAMRFNVSGWVKNLPNGSVAGCFEGEENDVAALIDWCRQGPGSARVSGVEVERGEF 80 
78223925   3 MKIRAIVTVKGLVQGVAFRHHTVLQGNQLRVTGWVKNLPNGDVQGCFEGDETDVQALVEWCHHGPSRARVDRVIVERKSF 82 
222055065 81 SGQFESFRISY 91 
39995995  81 RGEFDDFDVRY 91 
148263372 81 TGEFDDFHIAY 91 
78223925  83 RGEFDTFDVRY 93 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap