Conserved Protein Domain Family
PRK14437

?
PRK14437: PRK14437 
acylphosphatase; Provisional
Statistics
?
PSSM-Id: 172913
View PSSM: PRK14437
Aligned: 5 rows
Threshold Bit Score: 181.462
Threshold Setting Gi: 215919315
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
212213454   1 MGSDYVKISIEGLNMTQKEKNETCIHATVSGKVQGVFFRESVRKKAEELQLTGWVKNLSHGDVELVVCGERDSIMILTEW 80 
212219502   1 MGSDYVKISIEGLNMTQKEKNETCIHATVSGKVQGVFFRESVRKKAEELQLTGWVKNLSHGDVELVACGERDSIMILTEW 80 
215919315   1 --------------MTQKEKNETCIHVTVSGKVQGVFFRESVRKKAEELQLTGWVKNLSHGDVELVACGERDSIMILTEW 66 
161830672   1 --------------MTQKEKNETCIHATVSGKVQGVFFRESVRKKAEELQLTGWVKNLSHGDVELVACGERDSIMILTEW 66 
209364273   1 MGSDYVKISIEGLNMTQKEKNETCIHATVSGKVQGVFFRESVRKKAEELQLTGWVKNLSHGDVELVACGERDSIMILTEW 80 
212213454  81 LWEGPPQAAVSNVNWEEIVVEDYSDFRVR 109
212219502  81 LWEGPPQAAVSNVNWEEIVVEDYSDFRVR 109
215919315  67 LWEGPPQAAVSNVNWEEIVVEDYSDFRVR 95 
161830672  67 LWEGPPQAAVSNVNWEEIVVEDYSDFRVR 95 
209364273  81 LWEGPPQAAVSNVNWEEIVVEDYSDFRVR 109
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap