Conserved Protein Domain Family
PRK14436

?
PRK14436: PRK14436 
acylphosphatase; Provisional
Statistics
?
PSSM-Id: 172912
View PSSM: PRK14436
Aligned: 7 rows
Threshold Bit Score: 161.285
Threshold Setting Gi: 242399142
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
212224641  1 MERVRAHLKIYGRVQGVGFRWSMQREARKLGVSGWVRNLPDGTVEAVVEGDPERVEALIGWAHQGPSLARVTRVEVKWEE 80 
14591740   1 MAIVRAHLKIYGRVQGVGFRWSMQREARKLGVNGWVRNLPDGSVEAVLEGDEERVEALIGWAHQGPPLARVTRVEVKWEQ 80 
14521859   1 MGIVRAHLRIYGRVQGVGFRWSMQREARKLGVNGWVRNLPDGSVEAVLEGEEERVEALIGWAHQGPPFARVTRVEVKWEE 80 
18976655   1 MGIVRAHLRIYGRVQGVGFRWSMQREAKKLGVNGWVRNLPDGSVEAVLEGEEERVEALIGWAHQGPPLARVTRVEVTWEE 80 
57641966   1 MKRVRAHLRIYGRVQGVGFRWSMSREARKLGVHGWVRNLPDGTVEAVIEGDPERVEALIGWAHQGPPLARVTRVEVKWEE 80 
240102403  1 MRKVRAHLRIYGRVQGVGFRWSMQREARKLGLAGWVRNLPDGSVEAVVEGDEERVEALIGWAHQGPPLARVTRVEVKWEE 80 
242399142  1 MEIVRAHLRIYGRVQGVGFRWSMQREAKKLGVNGWVRNLPNGSVEAVIEGERERVEALIGWAHQGPSWARVTRVEVGWET 80 
212224641 81 PEGLEGFEVTG 91 
14591740  81 PKGEKGFRIVG 91 
14521859  81 PKGEKGFRIVG 91 
18976655  81 PKGEKGFRIIG 91 
57641966  81 PEGLEGFKVVG 91 
240102403 81 PEGLEGFKVIG 91 
242399142 81 PKGEKGFRVVG 91 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap