Conserved Protein Domain Family
PRK14430

?
PRK14430: PRK14430 
acylphosphatase; Provisional
Statistics
?
PSSM-Id: 172906
View PSSM: PRK14430
Aligned: 4 rows
Threshold Bit Score: 145.448
Threshold Setting Gi: 194290860
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
94312115   3 TTTETWQLFAHGRVQGVGYRAACADRATSLGLGGWVRNRVDGRVEVLASGPRERLEALRVWMEAGPPAAQVSKVEVAQAA 82 
194290860  1 MNKATWRLVAHGRVQGVGYRAACADAADDLGLGGWVRNRADGTVEVMAHGTVRQLEALQAWMETGPPAAQVTFVEVGRGD 80 
113869273  1 MKKETWRLVAHGRVQGVGYRAACADAADDLELGGWVRNRLDGTVEVMAHGTVRQLEALQAWMEQGPPAAQVTLVEVGPGE 80 
73542713   1 --METWHMTAHGRVQGVGYRAGCAQAAIALGVRGWVRNRADGTVEVMASGTIQQLEALRNWMQAGPPAAHVARVDVEPGQ 78 
94312115  83 PQlFDRFDWLPTA 95 
194290860 81 GE-FAGFELRPTV 92 
113869273 81 GE-FAGFEFRPTI 92 
73542713  79 GK-FEDFDLRPTL 90 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap