Conserved Protein Domain Family
PRK14428

?
PRK14428: PRK14428 
acylphosphatase; Provisional
Statistics
?
PSSM-Id: 172904
View PSSM: PRK14428
Aligned: 3 rows
Threshold Bit Score: 177.244
Threshold Setting Gi: 189439014
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
213691717  1 MRQSANLVRKHIAVTGLVQGVGFRYFTVTQARRLGVQGWVRNCRDGSVELEAQGSSDAVQALVEQLAIGPRWSEVSHVAV 80 
189439014  1 MRQSANLVRKHIVVNGLVQGVGFRYFTVTQARRLGVQGWVRNCRDGSVELEAQGSSDAVQALVEQLAIGPRWSEVSHVAV 80 
23465856   1 MRQSANLVRKHIVVTGLVQGVGFRYFTVTQARRLGVQGWVRNCRDGSVELEAQGSSDAVQALVEQLAIGPRWSEVSHVAV 80 
213691717 81 HDMPIIDETARAFGVRQ 97 
189439014 81 HDMPIIDETARAFGVRQ 97 
23465856  81 HDMPIIDETARAFGVRQ 97 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap