Conserved Protein Domain Family
PRK14427

?
PRK14427: PRK14427 
acylphosphatase; Provisional
Statistics
?
PSSM-Id: 172903
View PSSM: PRK14427
Aligned: 3 rows
Threshold Bit Score: 153.879
Threshold Setting Gi: 220911773
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
119960799   1 MTDETLRLTARITGVVQGVGFRYWTARKADELLLKGTVRNSADGSVELVAEGSAADVDSIVKWLHSSRAPGRVENVDFQV 80 
116669482  16 DAGQDVRLRARVEGVVQAVGFRYWTVRKAEELSLTGTVRNEDDGTVAVVVEGPQSVVLEFRRWLGSDDAPGRVDHVEESV 95 
220911773  12 PAAHQVRLSARVFGVVQGVGFRYRTMGEAEELGLTGEVKNLDDGSVALVAEGTGEQVEKLLDWLNSDRAPGRVERVDHTL 91 
119960799  81 SDATGEFDDFRIID 94 
116669482  96 SPATGEFSSFDVVY 109
220911773  92 SEIQGSFREFRAR- 104
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap