Conserved Protein Domain Family
PRK14425

?
PRK14425: PRK14425 
acylphosphatase; Provisional
Statistics
?
PSSM-Id: 172901
View PSSM: PRK14425
Aligned: 8 rows
Threshold Bit Score: 157.711
Threshold Setting Gi: 16265250
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
16265250   13 MTKDRRAALVRITGRVQGVCFRDWTREEAERLGLDGWVRNESDGSVTALIAGPDGAVSRMLDHFWKGPPGASVADVASEE 92 
150376340   1 MTKDRRAALVRITGRVQGVCFRDWTREEAEKLGLDGWVRNESDGSVTALIAGPDGAVSRMLENFWKGPPGASIADVASEV 80 
116252443   1 MFDHDKAVRVRISGKVQGVGFRYWTRDEAVRLGLTGWVRNEEDGAVVAVIAGPDSAISTMIERFRRGPSGASVSSVETEA 80 
86357993    1 MSDHNEAVRVRISGRVQGVGFRMWTRDEALRLGVTGWVRNEADGSVSALIAGADSAISAMIERLRRGPAGASVSGVETEV 80 
190892057   1 MSDRYEAVRVRITGRVQGVGFRIWTRDEALRLGLTGWVRNEADGSVAALVAGPDNVISAMIERLRRGPAGASVAGVETET 80 
209549604   1 MSAHYEALRVRVSGRVQGVGFRMWAREEALRLGLTGWVRNEADGSVAALIAGSDTAISTMIERFSRGPAGASVSGVETDA 80 
227820376  14 MAGDRKAALVRITGRVQGVCFRVWTRDEAERLGLTGWVRNESDGSVTALVAGPDAAVSAMLSRFWKGPPGASVTDVASED 93 
241204950   5 MFDHDKAVRVRISGKVQGVGFRYWTRDEAVRLGLTGWVRNEEDGAVVAVIAGPDSAISTMIERFRRGPLGASVSGVETEA 84 
16265250   93 ASSAEAPAGFRITR 106
150376340  81 ASSVEAPAGFRITR 94 
116252443  81 TQLEKNPTDFRITR 94 
86357993   81 AQLENMPRDFRITG 94 
190892057  81 VRLEKMPTDFRIT- 93 
209549604  81 TQLAEMPTDFRITA 94 
227820376  94 ASSSEAPKGFLITR 107
241204950  85 AQLEKNPTDFRITR 98 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap