Conserved Protein Domain Family
PRK14413

?
PRK14413: PRK14413 
glycerol-3-phosphate acyltransferase
Statistics
?
PSSM-Id: 172889
View PSSM: PRK14413
Aligned: 6 rows
Threshold Bit Score: 248.571
Threshold Setting Gi: 148380112
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
237795581   1 MIIIITSVISFLLGSIPTGYFITKKTCGIDIRTKGSGNIGSTNVKRIVGTKISIITQIIDVLKGIIPVVLGIYLSKIVKL 80 
15895765    2 IIVIITVMVSFLCGSIPTGYLITKKLSGIDVRTKGSGNIGSTNVKRVAGTKISMITQVMDILKGIIPVLLCMLIASKIKL 81 
150018656   1 MIIILSIIVSFLCGSIPTGYLIIKKLHGIDIRTKGSGNIGSTNVNRVVGRKISIITQIVDISKGIIPVALGICLAKIFEL 80 
148380112   1 MIIIITSVISFLLGSIPTGYFITKKACGIDIRTKGSGNIGSTNVKRIVGTKISIITQIIDVLKGIIPVVLGISLSKIVKL 80 
153933847   1 MIIIITSVISFLLGSIPTGYFITKKACGIDIRTKGSGNIGSTNVKRIVGTKISIITQIIDVLKGIIPVVLGISLSKIVKL 80 
153936676   1 MIIIITSVISFLLGSIPTGYFITKKACGIDIRTKGSGNIGSTNVKRIVGTKISIITQIIDVLKGIIPVVLGISLSKIVKL 80 
237795581  81 PVSTNTYLSTIAIAAILGHDYTPFLKFKGGKGVNTTLGVFIFIAPIPTLTGLAVYFILGLFTSIVSIRSIAIGITIPIMC 160
15895765   82 PISTSMYLSIIVIAVILGHDYTPFLGFNGGKGVNTTVGAFFLLAPAAVLAGAVVYFVLRLFTKIVSIKSIAVGITMPIAC 161
150018656  81 QMSMDTYLSIIAIAVILGHDFTPFLGFNGGKGVNTTIGAFFVIVPIPTLVGVAVHFILRLFTSIVSIRSIAIGVTIPLMC 160
148380112  81 PVSTDTYLSIIAIAAILGHDYTPFLKFKGGKGVNTTLGVFIFIAPIPTLTGLAVYFILGLFIRIVSIRSISIGITIPIMC 160
153933847  81 PVSTDTYLSIIAIAAILGHDYTPFLKFKGGKGVNTTLGVFIFIAPIPTLTGLAVYFILGLFIRIVSIRSISIGITIPIMC 160
153936676  81 PVSTDTYLSIIAIAAILGHDYTPFLKFKGGKGVNTTLGVFIFIAPIPTLTGLAVYFILGLFIRIVSIRSISIGITIPIMC 160
237795581 161 IITKLPIQIIISTTIAGILMVFRHKDNLVRIMRKEEK 197
15895765  162 IALRLPIEITVCAIIACGLLILRHKDNLIRLVNNEEK 198
150018656 161 IIMRAPVSIIVSSLIACVLMIYKHKDNLIRLLHNEEK 197
148380112 161 IITKLPIQIIISTTIACILMIIRHKDNLVRLIRGEEK 197
153933847 161 IITKLPIQIIISTTIACILMIIRHKDNLVRLIRGEEK 197
153936676 161 IITKLPIQIIISTTIACILMIIRHKDNLVRLIRGEEK 197
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap