Conserved Protein Domain Family
PRK14409

?
PRK14409: PRK14409 (this model, PSSM-Id:172885 is obsolete)
glycerol-3-phosphate acyltransferase
Statistics
?
PSSM-Id: 172885
View PSSM: PRK14409
Aligned: 6 rows
Threshold Bit Score: 286.344
Threshold Setting Gi: 183220802
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
183220802   1 MILAAILFSYLFGGIPVGYILTKQVRGIDIREHGSRNIGATNVGRVIGWKYGFIALLLDALKGAVPV-ISASYIesPYSL 79 
189910902   1 MILAAILFSYLFGGIPVGYILTKQVRGIDIREHGSRNIGATNVGRVIGWKYGFIALLLDALKGAVPV-ISASYIesPYSL 79 
24214004    2 NFPIFALFSFVSGSIPFGYWIALRFAGVDIRKLGSKNIGATNVGRLIGWKFGFIVLALDITKGMLPVyLSSVYV--PEGG 79 
45658261    2 NFPIFALFSFISGSIPFGYWIALRFAGVDIRKLGSKNIGATNVGRLIGWKFGFVVLALDITKGMLPVyLSSVYV--PEGG 79 
116330707   2 NFAIFAFLSFISGSIPFGYWIALRFGKMDIRKFGSKNIGATNVGRSIGWKFGFPVLVLDVAKGIFPVyLSGIYI--PEGG 79 
116328636   2 NFAIFAFLSFISGSIPFGYWIALRFGKMDIRKFGSKNIGATNVGRSIGWKFGFPVLVLDVAKGIFPVyLSGIYI--PEGG 79 
183220802  80 VTTEILLGSVAILGHTFTPFLHFKGGKGVATALGVYMTLVPVVTVCAIVIFFIVYKISGFVSLGSILATLSMPLWYFGSS 159
189910902  80 VTTEILLGSVAILGHTFTPFLHFKGGKGVATALGVYMTLVPVVTVCAIVIFFIVYKISGFVSLGSILATLSMPLWYFGSS 159
24214004   80 IPFQLLCGVCAVLGHMFSPFLGFRGGKGVATTFGVFLVLTPIACLGAVLVFWVVYKFFKFVSLGSIFASITLPLVYAFST 159
45658261   80 IPFQLLCGVCAVLGHMFSPFLGFRGGKGVATTFGVFLVLTPIACLGAVLVFWVVYKFFKFVSLGSIFASITLPLVYAFST 159
116330707  80 VPFQLACGVLAVLGHMFSPFLGFKGGKGVATTLGVFLVLTPIACFGAIFVFLVTIKYFKFVSIGSIFASLTLPLVYAFSS 159
116328636  80 VPFQLACGVLAVLGHMFSPFLGFKGGKGVATTLGVFLVLTPIACFGAIFVFLVTIKYFKFVSIGSIFASLTLPLVYAFSS 159
183220802 160 KVIPSAEYQPIIFFVLVATFFLITYSHRENIRRLVLGKELRASEDAK 206
189910902 160 KVIPSAEYQPIIFFVLVATFFLITYSHRENIRRLVLGKELRASEDAK 206
24214004  160 ILLLHEEVSYWVLGTMVFISFGIILTHRENIIRILNRSELFAVKGEE 206
45658261  160 ILLLHEEVSYWVLGTMVFISFGIILTHRENIIRILNRSELFAVKGEE 206
116330707 160 ILLLHEEVSYWILGTMVFISIGIILTHRENIFRILNRSELFAVKNED 206
116328636 160 ILLLHEEVSYWILGTMVFISIGIILTHRENIFRILNRSELFAVKNED 206
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap